Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000039335 (Spata16)
Chromosomal location
Chr 3: 26536553 - 26882136 (+)
Description
spermatogenesis associated 16 Gene [Source:MGI (curated);Acc:Spata16-001]
RefSeq_dna
NM_027583 NM_029150 
RefSeq_peptide
NP_081859.1 NP_083426.1 
UniGene
Mm.330943 
MGI
MGI:1918112 
Uniprot/SWISSPROT
Q8C636 
Human Ortholog
ENSG00000144962 (SPATA16)
Omim 102530 - GLOBOZOOSPERMIA  
UniTrap UNI35327
Vector Insertion
Chr 3: 26631858 - 26676426
Public Clones IST12950B9 (tigm) IST14257D6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28614
Vector Insertion
Chr 3: 26826402 - 26881841
Public Clones not available
Private Clones OST25862 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108305
Sequence
ACAGCAGGTTGGCCTGGGATTGGGACCGTTGGCACGACAGATGCTGTAGGTGGTAGTCACTCGGCTCCTCTGACCCTAAACCACACAG GAGTCTACGGG

TGGACCAATGGATTCTGGCAAGAGTAGGAGTTTGGAGACTACAGTGAAGAGAGTCTATCGAGATCTGCTTCTTCCAAAGATAAATACAAGCAAGAAAATG

TCCACCTTGACAAATTCCCCCAGCAGCCTGGAAGGGACACCTGGAATTAAGAAGAACAGTGGAGAAATGCAAGCTGAAGCCTCAGCTGAGAGAGTAAAAC

TCACAAAGAGCATCAAAGAAAAACAAAATAACGAGTTAGAGAAGGTGGCCCTTAAACGGAAGGCTGACAGCGAAGAGAAGCTGGTGGGAAAGAAAGAGGC

CAAGATAATGGAACTAGACAATCAGCTAGTCACCACCGTACCTCTGCCCCACATCCCCTTAAAGAACATAATGGATGTGGAAATGAAGCTGGTCTATGTT

GATGAAGAGGATGTGAGCTATGAGTTTGCCCAGCCTAACATGTGCCTTGGGCTTCAGGCAACAGGCCAGACTGCCACCACGATGCCACCTGCAAGTCCCC

GGGATCTCACCACCCTGCCACAGATTGACAAATGGCTTCAGGTAGCCTTAAAGGATGCCAGCTCTTGCTATAGACAGAAGAAATATGCCGTGGCAGCAGG

ACAGTTCAGGACAGCACTTGAG CTTTGCAGCAAAGGAGCAGCTCTGGGGAAACCCTTTGAAGCACACGCTGAAGACATAGCAAGCATCGCAAGTTTCAT

TGAGACAAAGCTCGTCACATGCTACCTACGTATGCGGAAGCCTGACCTTGCCCTGAACCATGCGCACAG - UNI35327 - GAGTATTGTTTTAAACC

CAGCCTATTTCCGAAACCATCTTCGTCAGGCAGCCGTGTTTAGATGTCTGGAGAGATACTCAGAAGCTGCCCG GAGTGCCATGATTGCGGACTACATGT

TCTGGCTCTGTGGAGGGAGCGAGCACTCTGTAAGCAAGCTCATCAAACTGTATTGGCAG GCCATGATTGAAGAAGCCATCACCAGGGCCGAAGCTTTCT

CGGTTATGTACACGCCCTTTGCAACAAGAATCAAGCCTGAGAACATAGAAAAGGTGAAAGAGGTGTTCATGAGAACTCACCCCACCTACGTGGACTGTAT

CTACACAG ATACCCAAGGACTCCATGTACTGCCGCAGACAGCCGACTGGTCGTGTTTTCCTCCCCAGCAATATCTGCTGACACTTGGGTTCAAAAACAA

AGAAGACGGGAAATTCTTGGAAAAAGTGTCCAGTAGGAAGCTCCCCACCTACACAG AACATAAAACTCCCTTCTCTCCACTGACCAGAGAAGATACAGT

GAGACACATGGAGACAGTGGGGAAGAGAATCCTGCCCATCCTGGACTTTATCCGGAGCACACAACTGAAT GGGAATTTCCATGCCTGCTCAGGTGTGAT

GGAGAAGTTGCACTATGCCAGCCTCCTCAGCCGGCTGCAGAGAGTGAAGGAACAGGCCCAGGTGATCAATCAAGCAATGGCAGAGCTGGCAACAGTCCCT

TATCTCCAGGACATCAGTCAACAGGAGGCAGAATTG CTGCAGTCGCTAATGGCAGACGCCATGGACACCCTTGAAGGAAAGAAGAGTGATAAGGAGCGT

GTGTGGAATACAATCCAAAAGGTAAAATTCTGAGCTGAAGGAAAATACATCTTATCCTCCGAGAAAATGTCTACCTTGGGTCAAATCTGTCTAGAAGATA

AAAAAGAAATG
Translation
 MDSGKSRSLETTVKRVYRDLLLPKINTSKKMSTLTNSPSSLEGTPGIKKNSGEMQAEASAERVKLTKSIKEKQNNELEKVALKRKADSEEKLVGKKEAK

IMELDNQLVTTVPLPHIPLKNIMDVEMKLVYVDEEDVSYEFAQPNMCLGLQATGQTATTMPPASPRDLTTLPQIDKWLQVALKDASSCYRQKKYAVAAGQ

FRTALE LCSKGAALGKPFEAHAEDIASIASFIETKLVTCYLRMRKPDLALNHAHR - UNI35327 - RSIVLNPAYFRNHLRQAAVFRCLERYSEAA

R RSAMIADYMFWLCGGSEHSVSKLIKLYWQ AMIEEAITRAEAFSVMYTPFATRIKPENIEKVKEVFMRTHPTYVDCIYTD DTQGLHVLPQTADWSCF

PPQQYLLTLGFKNKEDGKFLEKVSSRKLPTYTE EHKTPFSPLTREDTVRHMETVGKRILPILDFIRSTQLN GNFHACSGVMEKLHYASLLSRLQRVKE

QAQVINQAMAELATVPYLQDISQQEAEL LQSLMADAMDTLEGKKSDKERVWNTIQKVKF
Transcript ENSMUST00000047005
Sequence
AAGAGCTCTCTGAAGCTCCACAGCAGGTTGGCCTGGGATTGGGACCGTTGGCACGACAGATGCTGTAGGTGGTAGTCACTCGGCTCCTCTGACCCTAAAC

CACACAG GAGTCTACGGGTGGACCAATGGATTCTGGCAAGAGTAGGAGTTTGGAGACTACAGTGAAGAGAGTCTATCGAGATCTGCTTCTTCCAAAGAT

AAATACAAGCAAGAAAATGTCCACCTTGACAAATTCCCCCAGCAGCCTGGAAGGGACACCTGGAATTAAGAAGAACAGTGGAGAAATGCAAGCTGAAGCC

TCAGCTGAGAGAGTAAAACTCACAAAGAGCATCAAAGAAAAACAAAATAACGAGTTAGAGAAGGTGGCCCTTAAACGGAAGGCTGACAGCGAAGAGAAGC

TGGTGGGAAAGAAAGAGGCCAAGATAATGGAACTAGACAATCAGCTAGTCACCACCGTACCTCTGCCCCACATCCCCTTAAAGAACATAATGGATGTGGA

AATGAAGCTGGTCTATGTTGATGAAGAGGATGTGAGCTATGAGTTTGCCCAGCCTAACATGTGCCTTGGGCTTCAGGCAACAGGCCAGACTGCCACCACG

ATGCCACCTGCAAGTCCCCGGGATCTCACCACCCTGCCACAGATTGACAAATGGCTTCAGGTAGCCTTAAAGGATGCCAGCTCTTGCTATAGACAGAAGA

AATATGCCGTGGCAGCAGGACAGTTCAGGACAGCACTTGAG CTTTGCAGCAAAGGAGCAGCTCTGGGGAAACCCTTTGAAGCACACGCTGAAGACATAG

CAAGCATCGCAAGTTTCATTGAGACAAAGCTCGTCACATGCTACCTACGTATGCGGAAGCCTGACCTTGCCCTGAACCATGCGCACAG - UNI35327 

- GAGTATTGTTTTAAACCCAGCCTATTTCCGAAACCATCTTCGTCAGGCAGCCGTGTTTAGATGTCTGGAGAGATACTCAGAAGCTGCCCG GAGTGCC

ATGATTGCGGACTACATGTTCTGGCTCTGTGGAGGGAGCGAGCACTCTGTAAGCAAGCTCATCAAACTGTATTGGCAG GCCATGATTGAAGAAGCCATC

ACCAGGGCCGAAGCTTTCTCGGTTATGTACACGCCCTTTGCAACAAGAATCAAGCCTGAGAACATAGAAAAGGTGAAAGAGGTGTTCATGAGAACTCACC

CCACCTACGTGGACTGTATCTACACAG ATACCCAAGGACTCCATGTACTGCCGCAGACAGCCGACTGGTCGTGTTTTCCTCCCCAGCAATATCTGCTGA

CACTTGGGTTCAAAAACAAAGAAGACGGGAAATTCTTGGAAAAAGTGTCCAGTAGGAAGCTCCCCACCTACACAG AACATAAAACTCCCTTCTCTCCAC

TGACCAGAGAAGATACAGTGAGACACATGGAGACAGTGGGGAAGAGAATCCTGCCCATCCTGGACTTTATCCGGAGCACACAACTGAAT GGGAATTTCC

ATGCCTGCTCAGGTGTGATGGAGAAGTTGCACTATGCCAGCCTCCTCAGCCGGCTGCAGAGAGTGAAGGAACAGGCCCAGGTGATCAATCAAGCAATGGC

AGAGCTGGCAACAGTCCCTTATCTCCAGGACATCAGTCAACAGGAGGCAGAATTG CTGCAGTCGCTAATGGCAGACGCCATGGACACCCTTGAAGGAAA

GAAGAGTGATAAGGAGCGTGTGTGGAATACAATCCAAAAG - UNI28614 - GTCGGACGAATAGAAGACTTCCTGTACCAACTAGAAGACAGCTTCT

TAAAAACTAAGAAACTCAGAACCGCTCGAAGGCAGAAGACAAAGATGAAGAGACTTCAAACTGTACAGCAAAACTAGACACTAGGAAGCAGGCTGCCTGA

AGTGTCTGGAGAAGTTGGGGTCTGTAGCCTCTGGGTAACAAAGGCTGTCACCCAAGGCCTCAGATGGCACCCTCTTGGCAAAGACAGTCTACACTTCATT

ACTTTCAACTGGTAGCAATAAATGTTCTCGACTTGTTGGACTTATGCTC
Translation
 MDSGKSRSLETTVKRVYRDLLLPKINTSKKMSTLTNSPSSLEGTPGIKKNSGEMQAEASAERVKLTKSIKEKQNNELEKVALKRKADSEEKLVGKKEAK

IMELDNQLVTTVPLPHIPLKNIMDVEMKLVYVDEEDVSYEFAQPNMCLGLQATGQTATTMPPASPRDLTTLPQIDKWLQVALKDASSCYRQKKYAVAAGQ

FRTALE LCSKGAALGKPFEAHAEDIASIASFIETKLVTCYLRMRKPDLALNHAHR - UNI35327 - RSIVLNPAYFRNHLRQAAVFRCLERYSEAA

R RSAMIADYMFWLCGGSEHSVSKLIKLYWQ AMIEEAITRAEAFSVMYTPFATRIKPENIEKVKEVFMRTHPTYVDCIYTD DTQGLHVLPQTADWSCF

PPQQYLLTLGFKNKEDGKFLEKVSSRKLPTYTE EHKTPFSPLTREDTVRHMETVGKRILPILDFIRSTQLN GNFHACSGVMEKLHYASLLSRLQRVKE

QAQVINQAMAELATVPYLQDISQQEAEL LQSLMADAMDTLEGKKSDKERVWNTIQK - UNI28614 - VGRIEDFLYQLEDSFLKTKKLRTARRQKT

KMKRLQTVQQN

For any suggestions or comments, please send an email to unitrap@crg.es