Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000039395 (Mreg)
Chromosomal location
Chr 1: 72206020 - 72258881 (-)
Description
melanoregulin Gene [Source:MGI Symbol;Acc:MGI:2151839]
RefSeq_dna
NM_001005423 
RefSeq_peptide
NP_001005423.1 
UniGene
Mm.471705 
MGI
MGI:2151839 
Uniprot/SWISSPROT
Q6NVG5 
Human Ortholog
ENSG00000118242 (MREG)
Omim not available
UniTrap UNI8511
Vector Insertion
Chr 1: 72238777 - 72258590
Public Clones (sanger) RRO248 (baygenomics) D158B12 (ggtc) E129B02 (ggtc) D129B02 (ggtc)
E045H09 (ggtc) D077C12 (ggtc) FHCRC-GT-S4-1E1 (fhcrc) PST23060-NR (escells)
PST19552-NR (escells) Ayu21-T229 (egtc) IST13192B1 (tigm) IST14680A9 (tigm)
IST14617D2 (tigm) IST12991F10 (tigm) IST14991C12 (tigm) IST14992G7 (tigm)
IST15049E10 (tigm) IST14572E4 (tigm) IST14495E4 (tigm) IST11467A9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI371
Vector Insertion
Chr 1: 72210737 - 72238616
Public Clones GC1101 (tigem) AX0358 (sanger) RRG328 (baygenomics) RRT330 (baygenomics)
RRG049 (baygenomics) (ggtc) F017B06 (ggtc) D126D06 (ggtc) IST13077C10 (tigm)
IST13663B11 (tigm) IST14587F4 (tigm) IST14318D4 (tigm)
Private Clones OST426800 (lexicon) OST220276 (lexicon) OST36665 (lexicon)
Severity of mutation (?) Insertion after 40% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000048860
Sequence
CGGGCGGCACCCGGGGAATTAAAAGAGAGAGGGAAAAGCTCCCGCGGCAAACGCGCAGCTCGCGTCCCCACGGCCGGCCGCGGCGTGATGCGCACGGCCC

GGCCCGTGACGCCGCGGCCGTCCCTGTCCCCGTCCCCGCGTCCCCGCCGCCATCGCGCGCCCGGCTCCGGGATCCCGGCGCCGGGCCTCGCTCCCCATGG

GGCTGCGCCGCTGGCTACGGAGCGCCTGCTGCTGCTGCCCGTGCCGGTGCCTGGAGGAGCCCGCGCGGCCCGAGAAGGAGCCGCTGGTCAG - UNI851

1 - TGGTAACAATCCGTATTCCTCCTTTGGAGCGACTCTGGAGAGGGATGATGAGAAGAATTTATGGAGCATGCCTCATGACGTGTCCCACACAGAGGC

GGATGACGATAGGATCTTGTATAATTTGATAGTCATTCGTAATCAGCAGACCAAAGACTCAGAG - UNI371 - GAATGGCAAAGACTCAACTATGAT

ATCTACACCCTGCGGCAGATCCGCAGGGAAGTGAGGAACCGATGGAGACGAATCTTAGAGGACTTGG GCTTTCAAAGGGAAGCCGACTCTCTGTTGTCA

GTGACCAAACTCAGCACCATGAGTGATTCTAAAAACACAAGGAAAGCCCGGGAGATGCTGTTAAAGCTGGCTGAAGAGACCTCTATCTTCCCCGCCAGCT

GGGAGCTCTCCGAGAGGTACCTCTTGGTTGTG GACCGGCTCATTGCTCTCGATGCTGCTGAGGACTTCTTTAAGATTGCTAGCCAAATGTACCCCAAGA

AACCTGGGGTCCCATGCCTGGTGGACGGCCAGAGAAAACTGCACTGCCTTCCATTTCCAAGCCCCTGAAGGGAGGCCCAGAAGAGCGGAGTTCTTTTACC

ACGACACAGGAATTTACCAAAGTTGGACGGCTGCCTACGGTTTCGAGCGAGCCAGGAGAGGGCCTTCTCCAGTCAAACACTATCGTGAATCCTACAAATA

TAAGGTCTTCTTCCTCAGGACCTTGGCCTAAGGATGCTCTGGTTACATTAAAACACCCGGCTGCCACCATGCATCGAGAAAGGAAGGCTAAAGATTAGTT

GGTGGGTGGGTAGTTCTTCCTGGATAGTCAGGTTCCAAGAACCTGTGGCCTCATTGGCTATATAAGCTACAGTTGTTCATTCTGTGCAGGACTGGTGTTT

TCTAATCAACACAATGGCATGACTAATAGAGAAGGGTGTAACCGAGCCCTCACCTACATCACCAACTTCAAGGTAGTCATTATTAGGTGTAATACTAGAC

AAGGAGCCCCAGACTTCATAAAACCCTAGGCCTCGCGTGACCTGTTTGATTCGGAAACACCTGCAGCAGCTGAGATGCTGTTTGGGGCGTCCCTCTGAGC

ATCAGGGGGTGTTATTTACAAGTATAGGTGAGCCAGACAGTAGAAGTGTGCAGACGTGCAGCTAAGTGTCTTCACCTGTGCCACGAACACCCCGAACCCT

CATCTTAACCCCCAGCACTGACGTTACCCAGTTGCCTCGACTTTTTTTTTTTTTTTTAACATGTTGCCCATTTCTGATACAAAAGCCCTTGGCATTTTTA

TGAAGAATAGCATCTGTAAACTGGAGTGTTTGGCCTCTACTTCCTATCTTGAATCTGTGTCCTGAGGGTTGCAGCTGCCTAGGGACCTTTTGGTGCAGAC

TTGCAGGTATGCAGGCAGTGGTGTATGCTGACAGAGGTCGCTGCTGGGTCTTCACGCTGAAGGTGATTTTCAGACTGGAGCTCTGCTAGCAGTGCAGCTT

GCCCACAGAATGCCAAGCCCCACTTCCAAGATCGTAAGGAGCTTGCCAAGAGGACCGGGGCTCGTTCTGTTGAAAAGCCTTTCAAGATTTGTGGGATTTA

TCTGTAGACTTCTGAGAACAGTAGAAATATTTTTATTTTTTAATGATTTTGCACTTCTGAATTCAGGTGGAAAATAAATTTGTATTAGTTTGTTCAGGGG

ATTGTGACTTGAAAAATTTCATATCCTGAGGGTTTTTTTTTTTTTTTTTTGCTTGTATACTCCATGTTTAAAATATTTACTAGGAAATACATGTCCCCTG

TTCATTAATATATTGTAGACTAATTTAACAGGTGCATTTCAGGGAAATTCTTCCTAGTTTAATAAGTAAGCTAAAAGTTTTATTTTATTTTTTTAGTATT

TAGTGCATATTCTCTACTTCATGCTGTTTAAAATTAGCCTGCAAATATTTTCAGTCACTTCTGTGGGCTATTAGAAGATAAAGAATAAAATAAACAAAAG

ACATCCT
Translation
MGLRRWLRSACCCCPCRCLEEPARPEKEPLVS - UNI8511 - SGNNPYSSFGATLERDDEKNLWSMPHDVSHTEADDDRILYNLIVIRNQQTKDSE 

- UNI371 - EWQRLNYDIYTLRQIRREVRNRWRRILEDLG GFQREADSLLSVTKLSTMSDSKNTRKAREMLLKLAEETSIFPASWELSERYLLVV D

RLIALDAAEDFFKIASQMYPKKPGVPCLVDGQRKLHCLPFPSP

For any suggestions or comments, please send an email to unitrap@crg.es