Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000039431 (Mtmr7)
Chromosomal location
Chr 8: 41636455 - 41720110 (-)
Description
myotubularin related protein 7 Gene [Source:MGI Symbol;Acc:MGI:1891693]
RefSeq_dna
NM_001040699 
RefSeq_peptide
NP_001035789.1 
UniGene
Mm.294871 
MGI
MGI:1891693 
Uniprot/SWISSPROT
Q9Z2C9 
Uniprot/SPTREMBL
Q8K0A2 
Human Ortholog
ENSG00000003987 (MTMR7)
Omim not available
UniTrap UNI29404
Vector Insertion
Chr 8: 41694371 - 41720051
Public Clones RRM395 (baygenomics) IST12219A4 (tigm) IST11260G3 (tigm) IST12466H2 (tigm)
IST10070B12 (tigm) IST14968C11 (tigm) IST12224F6HMR1 (tigm) IST10945D5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6384
Vector Insertion
Chr 8: 41692276 - 41694247
Public Clones YHC209 (baygenomics) IST11329A6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35663
Vector Insertion
Chr 8: 41682636 - 41692276
Public Clones IST13087F4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33069
Vector Insertion
Chr 8: 41666767 - 41672537
Public Clones IST10669D7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15588
Vector Insertion
Chr 8: 41649313 - 41666901
Public Clones (sanger) PST2635-NR (escells) IST14734E10 (tigm) IST12013D8 (tigm)
IST10746E3 (tigm) IST10490H4 (tigm) IST11764D3 (tigm) IST13504F4 (tigm)
IST12483D8 (tigm) IST12577A9 (tigm) IST14996A8 (tigm) IST11607D10 (tigm)
IST10616A6 (tigm) IST11590F10 (tigm) IST14041F3 (tigm) IST10045F9 (tigm)
IST10997E3 (tigm) IST10926D6 (tigm) IST10843H5 (tigm) IST13038G5 (tigm)
IST10260A8 (tigm) IST10708B12 (tigm) IST11670B3 (tigm) IST10435F9 (tigm)
IST11766D3 (tigm) IST12927E1 (tigm) IST14590A2 (tigm) IST10008F8 (tigm)
IST10770H2 (tigm) IST11157C10 (tigm) IST14055B1 (tigm) IST10693A9 (tigm)
IST12808A8 (tigm) IST10282G9 (tigm) IST12157B11BBR1 (tigm) IST11807D12 (tigm)
IST14915F2 (tigm) IST13358G6 (tigm) IST10931F2 (tigm) IST10746E2 (tigm)
IST10743E6 (tigm) IST11548D6 (tigm) IST10464F5 (tigm) IST13763B9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9024
Vector Insertion
Chr 8: 41643711 - 41646210
Public Clones XF423 (baygenomics) XF516 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 82% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000048898
Sequence
GCGCCCGCCGGGGACCCTGCAGACGCGGGCCCGCCATGGAGCACATCCGCACGCCCAAG - UNI29404 - GTTGAAAACGTGCGCTTGGTAGACAGA

GTGTCTTGTAAAAAGGCAGCGCTGGGAACTTTGTATCTGACGGCCACTCACGTCATATTCGTGGAAAATGCACCTGACACAAGAAAAGAAACCTGG - U

NI6384 - - UNI35663 - ATTCTGCACAGTCAGATCTCCACCATTGAAAAGCAGGCGACAACAGCTACGGGCTGCCCTCTGCTTATTCGCTGCAAG

AACTTCCAGATCGTACAACTTGTCATTCCACAGGAGAGAGACTGCCACGACGTGTACATCTCTCTGATACGCCTTGCACGGCCAG - UNI35663 - T

GAAGTACGAGGAGCTATACTGCTTTTCCTTCAACCCCAAGCTGGATAAGGAAGAACGGGAGCAGGGCTGGTTGCTGGTTGACCTTAGTGAAGAATACAAG

CGAATGGGCCTCCCTGATAATTATTGGCAGCTCAGCGATGTGAATAGAGACTACAGA - UNI35663 - GTTTGTGACTCTTACCCCACGGAACTGTA

CGTCCCCAGATCGGCCACGGCACACATCATCGTGGGCAGCTCCAAGTTCCGGAGCAGACGGCGATTTCCTGCCCTTTCCTACTACTGTAAAGACAGCCAT

 - UNI33069 - GCCTCCATCTGCAGGAGCAGCCAGCCCCTTTCCGGCTTCAGCGCTCGGTGCCTGGAGGATGAGCAGATGCTCCAAGCCATCAGGAA

AGCCAATCCTGGAAGTGACTTCATTTATGTCGTGGACACAAGGCCTAAA - UNI15588 - - UNI33069 - CTTAATGCGATGGCAAATCGTGCT

GCAGGGAAAGGCTATGAGAATGAAGACAATTATTCCAATATCAAGTTTCAGTTTATCGGCATAGAGAACATCCACGTCATGAGGAACAGTCTTCAGAAAA

TGCTGGAAG - UNI15588 - - UNI33069 - TGTGTGAACTTAAATCTCCCTCTATGAGTGATTTCCTGTGGGGACTGGAGAACTCAGGCTGGCT

GAGGCACATCAAAGCCATCATGGATGCAGGGATCTTCATTGCAAAG - UNI15588 - GCAGTTTCAGAGGAAGGGGCAAGTGTGCTTGTTCACTGTT

CTGACGGCTGGGACAGAACGGCCCAGGTGTGCTCGGTGGCTAGCCTGCTGCTGGACCCTTACTACCGGACTCTGAAAGGATTCATG GTATTAATTGAAA

AGGACTGGATTTCCTTCGGACATAAATTTAATCATAG - UNI9024 - ATATGGCAACTTAGATGGTGACCCAAAAGAAATCTCTCCAGTAATCGACC

AGTTCATTGAGTGTGTCTGGCAGCTAACGGAACAGTTCCCTTGCGCCTTTGAGTTCAACGAGAGGTTTCTGACTCACATTCAGCATCATGTTTATTCCTG

CCAGTTTGGGAACTTCCTGTGTAATAGCCAGAAGGAGAGGCGAGAACTCAA TGAGAATGGAAAAAGCAAAAAGGGTTCACGGTTCCTTAAGGAGGACTC

CTGA
Translation
MEHIRTPK - UNI29404 - VENVRLVDRVSCKKAALGTLYLTATHVIFVENAPDTRKETW - UNI6384 - - UNI35663 - ILHSQISTIEK

QATTATGCPLLIRCKNFQIVQLVIPQERDCHDVYISLIRLARPV - UNI35663 - VKYEELYCFSFNPKLDKEEREQGWLLVDLSEEYKRMGLPDNY

WQLSDVNRDYR - UNI35663 - VCDSYPTELYVPRSATAHIIVGSSKFRSRRRFPALSYYCKDSH - UNI33069 - ASICRSSQPLSGFSARCL

EDEQMLQAIRKANPGSDFIYVVDTRPK - UNI15588 - - UNI33069 - LNAMANRAAGKGYENEDNYSNIKFQFIGIENIHVMRNSLQKMLEV 

- UNI15588 - - UNI33069 - VCELKSPSMSDFLWGLENSGWLRHIKAIMDAGIFIAK - UNI15588 - AVSEEGASVLVHCSDGWDRTAQV

CSVASLLLDPYYRTLKGFM VLIEKDWISFGHKFNHR - UNI9024 - RYGNLDGDPKEISPVIDQFIECVWQLTEQFPCAFEFNERFLTHIQHHVYS

CQFGNFLCNSQKERRELN NENGKSKKGSRFLKEDS
Transcript ENSMUST00000048890
Sequence
GCGCCCGCCGGGGACCCTGCAGACGCGGGCCCGCCATGGAGCACATCCGCACGCCCAAG - UNI29404 - GTTGAAAACGTGCGCTTGGTAGACAGA

GTGTCTTGTAAAAAGGCAGCGCTGGGAACTTTGTATCTGACGGCCACTCACGTCATATTCGTGGAAAATGCACCTGACACAAGAAAAGAAACCTGG - U

NI6384 - - UNI35663 - ATTCTGCACAGTCAGATCTCCACCATTGAAAAGCAGGCGACAACAGCTACGGGCTGCCCTCTGCTTATTCGCTGCAAG

AACTTCCAGATCGTACAACTTGTCATTCCACAGGAGAGAGACTGCCACGACGTGTACATCTCTCTGATACGCCTTGCACGGCCAG - UNI35663 - T

GAAGTACGAGGAGCTATACTGCTTTTCCTTCAACCCCAAGCTGGATAAGGAAGAACGGGAGCAGGGCTGGTTGCTGGTTGACCTTAGTGAAGAATACAAG

CGAATGGGCCTCCCTGATAATTATTGGCAGCTCAGCGATGTGAATAGAGACTACAGA - UNI35663 - GTTTGTGACTCTTACCCCACGGAACTGTA

CGTCCCCAGATCGGCCACGGCACACATCATCGTGGGCAGCTCCAAGTTCCGGAGCAGACGGCGATTTCCTGCCCTTTCCTACTACTGTAAAGACAGCCAT

 - UNI33069 - GCCTCCATCTGCAGGAGCAGCCAGCCCCTTTCCGGCTTCAGCGCTCGGTGCCTGGAGGATGAGCAGATGCTCCAAGCCATCAGGAA

AGCCAATCCTGGAAGTGACTTCATTTATGTCGTGGACACAAGGCCTAAA - UNI15588 - - UNI33069 - CTTAATGCGATGGCAAATCGTGCT

GCAGGGAAAGGCTATGAGAATGAAGACAATTATTCCAATATCAAGTTTCAGTTTATCGGCATAGAGAACATCCACGTCATGAGGAACAGTCTTCAGAAAA

TGCTGGAAG - UNI15588 - - UNI33069 - TGTGTGAACTTAAATCTCCCTCTATGAGTGATTTCCTGTGGGGACTGGAGAACTCAGGCTGGCT

GAGGCACATCAAAGCCATCATGGATGCAGGGATCTTCATTGCAAAG - UNI15588 - GCAGTTTCAGAGGAAGGGGCAAGTGTGCTTGTTCACTGTT

CTGACGGCTGGGACAGAACGGCCCAGGTGTGCTCGGTGGCTAGCCTGCTGCTGGACCCTTACTACCGGACTCTGAAAGGATTCATG GTATTAATTGAAA

AGGACTGGATTTCCTTCGGACATAAATTTAATCATAG - UNI9024 - ATATGGCAACTTAGATGGTGACCCAAAAGAAATCTCTCCAGTAATCGACC

AGTTCATTGAGTGTGTCTGGCAGCTAACGGAACAGTTCCCTTGCGCCTTTGAGTTCAACGAGAGGTTTCTGACTCACATTCAGCATCATGTTTATTCCTG

CCAGTTTGGGAACTTCCTGTGTAATAGCCAGAAGGAGAGGCGAGAACTCAA GATTCAAGAAAGAACCTACTCTTTGTGGTCCAACCTGTGGAAGAATCG

AGCTGACTACCTCAATCCTCTGTTTAGAGCTGACCACAGTCAGACCCAGGGGAGCCTTCATCTGCCTACAGCTCCATGCAACTTCACCTATAA GTTTTG

GAATGGGATGTATAACCGCTTTGAAAAGGGGTTGCAGCCTCGACAGTCTGTTACAGATTACCTCATGGCTGTGAAGGAGGAGTCCCAGCAGCTGGAGGAA

GAACTGGAGTCCCTAGAAGAA AGGCTGGAAAAAATTCAGAAAGTCCACTTACATGGTACCAAAGTGAAGAGTAAGCAAAGTGAGCCCAGCAAACACTCG

GGGTTCTCTACCTCAGACCACAGCACAGCCAACACCCCTCAGGATTACAGTGGGAACAGCAAGTCCTTCCCATCCAGGAGCCCGTCCCAGGGTGATGAAG

ATTCTGCTCTGATTCTAACCCAAGACAATTTAAAAAGCTCAGACCCCGACCTCTCAGTGAATAGTGATCAAGAGTCTGGGGTGGAGGATTTGAGCTGTCG

ATCTCCCAGTGGTGGTGAGCATGCACCCAGCGAAGACAGTGGCAAGGACCGGGACTCGGACGAAGCTGTGTTTCTCACTGCCTAAGTTCCCCTTTGGAGT

TCCAAAGTAAAAGACACAGAAACACTTTCAAATTAAGGGGAAAGTGCAATTCGTAGTAAAAATGTTGAGAAATGGCAAGTTCTATCCAGAACCATAAAAT

TACAGCTGTGAAAATGGGGAAAAAAAAGCTCTTTATCAATAACCAGTTGTTTTATCAAATCATACTGAAGACTGATCATCATTCCTGAGGCTCATGCTAG

ACTATGAAAATTATATCACTACAAGGAGAGAGAGTATCTTCACCCAAGGTTGTCCAGACAGTCTTTCCTGGCATAGCATGTGTCTGCTTAAAAGCCCTCC

TGGTTTCTCCCATACCTGATAATGTTGGGACTTTGATTTCACTTCCAGTTGCAGGTTGCATTCAGGAACTTTGACATTTCCTTCTGCCTTTACCAATATT

TAAAAGAAATAAATATGGAGAGTACCCTTTTCTGT
Translation
MEHIRTPK - UNI29404 - VENVRLVDRVSCKKAALGTLYLTATHVIFVENAPDTRKETW - UNI6384 - - UNI35663 - ILHSQISTIEK

QATTATGCPLLIRCKNFQIVQLVIPQERDCHDVYISLIRLARPV - UNI35663 - VKYEELYCFSFNPKLDKEEREQGWLLVDLSEEYKRMGLPDNY

WQLSDVNRDYR - UNI35663 - VCDSYPTELYVPRSATAHIIVGSSKFRSRRRFPALSYYCKDSH - UNI33069 - ASICRSSQPLSGFSARCL

EDEQMLQAIRKANPGSDFIYVVDTRPK - UNI15588 - - UNI33069 - LNAMANRAAGKGYENEDNYSNIKFQFIGIENIHVMRNSLQKMLEV 

- UNI15588 - - UNI33069 - VCELKSPSMSDFLWGLENSGWLRHIKAIMDAGIFIAK - UNI15588 - AVSEEGASVLVHCSDGWDRTAQV

CSVASLLLDPYYRTLKGFM VLIEKDWISFGHKFNHR - UNI9024 - RYGNLDGDPKEISPVIDQFIECVWQLTEQFPCAFEFNERFLTHIQHHVYS

CQFGNFLCNSQKERRELK KIQERTYSLWSNLWKNRADYLNPLFRADHSQTQGSLHLPTAPCNFTYK KFWNGMYNRFEKGLQPRQSVTDYLMAVKEESQ

QLEEELESLEE RLEKIQKVHLHGTKVKSKQSEPSKHSGFSTSDHSTANTPQDYSGNSKSFPSRSPSQGDEDSALILTQDNLKSSDPDLSVNSDQESGVE

DLSCRSPSGGEHAPSEDSGKDRDSDEAVFLTA

For any suggestions or comments, please send an email to unitrap@crg.es