Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000039456 (Morc3)
Chromosomal location
Chr 16: 93832529 - 93876317 (+)
Description
microrchidia 3 Gene [Source:MGI Symbol;Acc:MGI:2136841]
RefSeq_peptide
NP_001038994.1 
UniGene
Mm.287329 Mm.395993 
MGI
MGI:2136841 
Uniprot/SPTREMBL
A6H605 Q4QQR6 Q6A0C2 Q8R0R0 
Human Ortholog
ENSG00000159256 (MORC3)
Omim not available
UniTrap UNI625
Vector Insertion
Chr 16: 93832594 - 93841615
Public Clones AD0408 (sanger) AY0345 (sanger) (sanger) BGB160 (baygenomics) E132B12 (ggtc)
M053A07 (ggtc) IST12032D11 (tigm) IST15052F6 (tigm)
Private Clones OST371059 (lexicon) OST196570 (lexicon) OST170759 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25284
Vector Insertion
Chr 16: 93841689 - 93844438
Public Clones not available
Private Clones OST189147 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28473
Vector Insertion
Chr 16: 93844572 - 93845384
Public Clones not available
Private Clones OST30195 (lexicon)
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18835
Vector Insertion
Chr 16: 93847676 - 93849374
Public Clones not available
Private Clones OST413326 (lexicon)
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10146
Vector Insertion
Chr 16: 93849523 - 93853333
Public Clones XB586 (baygenomics)
Private Clones OST343698 (lexicon) OST33921 (lexicon)
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28466
Vector Insertion
Chr 16: 93860843 - 93862658
Public Clones not available
Private Clones OST30314 (lexicon)
Severity of mutation (?) Insertion after 43% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5554
Vector Insertion
Chr 16: 93862961 - 93865204
Public Clones YTA199 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 50% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30190
Vector Insertion
Chr 16: 93866784 - 93870608
Public Clones D085E07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 58% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21251
Vector Insertion
Chr 16: 93873640 - 93875003
Public Clones not available
Private Clones OST337083 (lexicon)
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000044068
Sequence
GGTCCTGGCTTTGTAGCTCACTCAAGATGGCGGCGCAGCCACCCACCGGGATCCGCCTCAGCGCG - UNI625 - CTTTGCCCGAAGTTTTTACATAC

AAATTCTACTAGTCATACCTGGCCGTTCAGTGCAGTTGCTGAGTTAATAG - UNI25284 - ATAATGCTTATGATCCTGATGTGAATGCTAAACAGA

TCTGGATCGATAAAACAGTGATTAGTGACCATATATGCTTGACATTCACTGATAATGGCAACGGGATGACAGCAGATAAGTTACATAAAATGCTAAG - 

UNI28473 - CTTTGGCTTCAGTGACAAAGTCACCATGAATGGTCATGTCCCAGTTGGATTGTACGGGAATGGCTTCAAGTCAGGTTCTATGCGACTGG

GCAAAGATGCAATGGTTTTTACCAAAAATGGAGAAACCATGAGTGTGGGCTTCTTGTCTCAGACCTACCTGGAAGTCATAAAGGCGGAGCACGTTGTTGT

CCCGATCGTGACGTTCAACAAACAC CGTCAGATGATTAATTTAACAGAATCAAAAGCAAGCCTAGCAGCAATTCTGGAACATTCTCTGTTTTCTACGGA

ACAGAAATTACTGGCAGAACTCAATGCTATCATGGGTAAGAAGGGGACAAGAATCATCATTTGGAATCTCAGAAG - UNI18835 - TTACAAAAATG

CAACAGAATTTGATTTTGAAAAGGATAAATACGACATCAGAATTCCTGAGGATTTAGATGAGACTGCAGGGAGGAAAGGGTACAAGAAACAAGAAAGAAT

GGACCAAATTGCCCCTGAGAGTGACTATTCCTTAAGG - UNI10146 - GCTTACTGCAGCATTTTATACCTTAAACCAAGAATGCAGATCATCATAC

GTGGACAGAAAGTGAAGACACAACTAGTTTCAAAGAGTCTTGCCTACATTGAACGTGATGTTTACCGACCTAAATTTTTA ACTAGAACAGTGAGAATTA

CTTTTGGATTCAACTGCAGAAATAAAGATCACTATGGGATAATGATGTATCACAAAAACAGACTCATCAAGGCTTATGAAAAAGTAGGATGTCAGTTAAA

G GCAAACAACATGGGTGTTGGAGTGGTTGGAATTATAGAATGTAATTTCCTTAAGCCAACTCATAATAAGCAAGATTTTGACTACACTAATGAGTACAG

 GCTTACGATACTAGCACTAGGAGAAAAGCTGAATGATTATTGGAATGAAATGAAAGTGAAAAAAAATGCAGAATATCCTGTAAACTTGCCAGTCGAAGA

CATACA - UNI28466 - GAAGCGTCCTGATCAGACATGGGTTCAATGTGACGCTTGTCTAAAGTGGCGAAAGTTACCAGATGGGATAGATCAGCTTC

CAGAAAAATGGTATTGCTCCAATAACCCTGACCCACAGTTCAG AAACTGTGAAGTTCCGGAAGAACCTGAAGATGAGGATTTAGTGCATCCTACTTATG

AGAAAACCTATAAAAAGAC - UNI5554 - GAGCAAGGAGAGATTCAGGATCAGACAACCGGAAATCCTCCCTCGAATCCTCCCTCAG ATTAACCCT

GAGCTATTGTATCAGACAAGTGTTTCAAGTCAGAGCTTCTCCCCTGTGAAGGAGAGCGTTCCAAGACCACATCTTTCTGAAGTCACGAGTCCCTTTGCAG

CAAGGATTATAAATCTCAACCTTGCTTCACCAGCGTCTGAACCTGAGAACAGTAG - UNI30190 - CATGAAGCGGAAACTTGGTGTTCACTCATCA

ATTCTGAATGCAAAGACTCGGAGATTAAGTAATCCTCCAGTTGAAAATTCATCTTACAAAAATGATGATGATGAAGATGTCATCATTTTAGAAGAAAATA

GTACCCCCAAGCCTGCAGTAGATCTTGAAGTTAAATCAGATATTGAAGTCAAGTCAGAACAGAGCCACACTGAGCAGAGCGGCATTCATGTTGACCTTGT

AAGCAGTCCTAAGCCTTGTGTCCAGGCCAGTTCCACAAGCACTTCCACCTCCAGGAGTGACCCAGGCATTACGGTCTCCACTCAGACCGATGCACCAGGC

CTGACCGTGAAAAAGGAAGAAAGTATGGAAGAGGACATGGGTGTGAGGAACGGCACAGCCACCCTGTCCTGTGTCGGTACTGAGGCAAAAGTGCAGGAGA

CCTCGGCTGAGTCGGTAGATGCCACTAGCCATCAGTTACAAGAACTGAGAAGTGAGCTGCTTGTAGTCACACAAGAAAGAGATGATTACAAGAGACAGTG

CCAGATGTTTACTGATCAGATACAGGTGTTACAGCAAAGACTATTGGAGATGAACGACAAGTGCGTGAAGAAGGAGAAGTGCCACCAGTCTACTGAAACT

GACGCAGTGTTTCTACTTGACAGTGTTAACGGTCAGGCTGAGAGCCTGGACCACTTGGGGTCTCAGTACCAGCAAGCACTGCAGGAGATAGAAAGGCTGA

AGAGACAGTGCAGCGCGCTGCAGCAGGTGAAGAGTGAGTGCAGCCAGGCTTCCTGCACTGAGAGCAAAAGCGAGGTGGACGAGATGGCCGTGCAGCTTGA

TGATGTGTTCAGGCAGCTGGACAAGTGCACCATTGAGAGGGACCAGTACAAGAACGAG GTTCAGTTGTTGGAAATAGAGAAGTCACACATTCATTCTCA

GTGTGAAGAGCTGCAGACTGAAGTGGAGCAGCTGAAGTCCACAGGCCAACAGGCAGCGGCCGATGGGTCCACTGCAAGCAATGCCGAGGAGCCTGTCAGT

TATGTGGACGGGGAAAG - UNI21251 - CCTCAAACTTCGTTCTCTTCGAGTCAACGTAGGACAGCTGCTGGCTATGATCGTGCCTGATCTGGATCT

TCAGCAGGTCAATTATGACGTGGACGTAGTCGATGAGATTCTAGGACAAGTGGTGGAGCAGATGAGCGAGATCAGCAGTACTTAAGTGCAGACGTCTGGT

GATGGTTTCAGCTCTCACGTAACGCGTGCCAGGTCACAGACTGAAGAGCGGCATCTTTCTGTATTCTATGCATTCGAGTGTCCCAGGCACTGTGGACACA

CAACTCTTGACATAACCTGTGAACTGCTGGGGTTGAGCAGCGTAATAGCGAACTTAGCCTCTGTTCTAAATGTCAATATTTGTATTAAGTCCACAAATAT

TTTTTTATTGCCCTAGAGACTGGTGTTTTTCACCAAGAGCTTTTCAGGTTGTTACAATACAGTTTGTGCAATTTTTCTGGCTCCCTAAATGTATTTTTCT

CAAAATCGAGGGCTGTGCCATAGTGTATGTAAATGGATAAGTTGCTACTGTTGTTTCCTTAAATGAGCATAAGACAGGATTTGAAATAATGTCATGGCAC

TCCTAGCGGGGTCTGCTTGTAAGGGAATTGAGCATTACTGCTGTTTTCTATGAAATCCTGTCTCTGACATGATTCTGTTCATAGAGAGGAAAGCCAAAGC

TAGCTGAGTTTGCCTGGCTTTTTCTTGTGGTAAGATTGCTAATTGTCAAGTAAAAAGTGTTTTCCAGGACAAAGAAAAGATCTTTAAAGTGTTAAAAAAT

ATCCAGTGACAACCATGTTTACTTTGAAGCCCATTTTTGGCTGTTGATTCAGCATGAAGTGGGTGCAATAATTATTTGAGATTTCTTTTTGTGAAATTTC

CTGTATAGCCTTTGTAGGGTTACTGCAGGTTAATGTAAGCTGAGAAGGTAGTCTTTCTCAAACAGTACTGCATATCTTTTACTGTATTATGAATGTAAGT

GTTTTTTAGCCTGGAGTTAATCATAAATGGGCCTGGGATCATAGCACCATATGCTGTAAAATATGCTTTTACTGGTCCCAAGTTTTGTGCAATCTGAAAA

GAGGTGGCTTTTTATTATATATGTAACTGTATATAATTAAGAATCATATTTTCCACAACTAAAAATGTGTTATTTTTTCCAAAGTTTTATTGTTGCTATT

TATTTTAACTTTTGTTTCTGAAAATTCAGTACATACTCATTGTGTGTGTGGTTAACTACACATCTGTTGTATACGAAGTTGAATCTTTATGTATAGTACC

TTCTGGGAATTGCAAATAAATGAAGTTCTTGTTTTTATTTACTCG
Translation
MAAQPPTGIRLSA - UNI625 - LCPKFLHTNSTSHTWPFSAVAELID - UNI25284 - DNAYDPDVNAKQIWIDKTVISDHICLTFTDNGNGMT

ADKLHKMLS - UNI28473 - SFGFSDKVTMNGHVPVGLYGNGFKSGSMRLGKDAMVFTKNGETMSVGFLSQTYLEVIKAEHVVVPIVTFNKH RQMI

NLTESKASLAAILEHSLFSTEQKLLAELNAIMGKKGTRIIIWNLRS - UNI18835 - SYKNATEFDFEKDKYDIRIPEDLDETAGRKGYKKQERMDQ

IAPESDYSLR - UNI10146 - AYCSILYLKPRMQIIIRGQKVKTQLVSKSLAYIERDVYRPKFL TRTVRITFGFNCRNKDHYGIMMYHKNRLIKAY

EKVGCQLK ANNMGVGVVGIIECNFLKPTHNKQDFDYTNEYR RLTILALGEKLNDYWNEMKVKKNAEYPVNLPVEDIQ - UNI28466 - QKRPDQT

WVQCDACLKWRKLPDGIDQLPEKWYCSNNPDPQFR RNCEVPEEPEDEDLVHPTYEKTYKKT - UNI5554 - TSKERFRIRQPEILPRILPQ INPE

LLYQTSVSSQSFSPVKESVPRPHLSEVTSPFAARIINLNLASPASEPENSS - UNI30190 - SMKRKLGVHSSILNAKTRRLSNPPVENSSYKNDDD

EDVIILEENSTPKPAVDLEVKSDIEVKSEQSHTEQSGIHVDLVSSPKPCVQASSTSTSTSRSDPGITVSTQTDAPGLTVKKEESMEEDMGVRNGTATLSC

VGTEAKVQETSAESVDATSHQLQELRSELLVVTQERDDYKRQCQMFTDQIQVLQQRLLEMNDKCVKKEKCHQSTETDAVFLLDSVNGQAESLDHLGSQYQ

QALQEIERLKRQCSALQQVKSECSQASCTESKSEVDEMAVQLDDVFRQLDKCTIERDQYKNE VQLLEIEKSHIHSQCEELQTEVEQLKSTGQQAAADGS

TASNAEEPVSYVDGES - UNI21251 - SLKLRSLRVNVGQLLAMIVPDLDLQQVNYDVDVVDEILGQVVEQMSEISST

For any suggestions or comments, please send an email to unitrap@crg.es