Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000039496 (Armetl1)
Chromosomal location
Chr 2: 3430335 - 3443648 (+)
Description
arginine-rich, mutated in early stage tumors-like 1 Gene [Source:MGI (curated);Acc:Armetl1-001]
RefSeq_dna
NM_177647 
RefSeq_peptide
NP_808315.1 
UniGene
Mm.211455 
MGI
MGI:3606576 
Uniprot/SWISSPROT
Q8CC36 
Human Ortholog
ENSG00000185267 (ARMETL1)
Omim not available
UniTrap UNI31080
Vector Insertion
Chr 2: 3430514 - 3436572
Public Clones IST14544G9 (tigm) IST12295G3 (tigm) IST13515E3 (tigm) IST11599G3 (tigm)
IST14413B2 (tigm) IST14446A3 (tigm) IST10767F2 (tigm) IST10555B5 (tigm)
IST10034D4 (tigm) IST10901F5 (tigm) IST12765B1 (tigm) IST10731G5 (tigm)
IST10314A10 (tigm) IST12875D3 (tigm) IST14144B7 (tigm) IST13871F6 (tigm)
IST10844D2 (tigm) IST14490A3 (tigm) IST14623E6 (tigm) IST11502C5 (tigm)
IST14790H12 (tigm) IST13934E4 (tigm) IST11552A9 (tigm) IST10453B11 (tigm)
IST14675F8 (tigm) IST13054C6 (tigm) IST10119D5 (tigm) IST10684F10 (tigm)
IST11049H10 (tigm) IST10852G4 (tigm) IST11054C2 (tigm) IST10684H10 (tigm)
IST15095B10 (tigm) IST14375E2 (tigm) IST10827A2 (tigm) IST10609D10 (tigm)
IST12087B1 (tigm) IST14330D9 (tigm) IST10286D5 (tigm) IST12058G2 (tigm)
IST10851G5 (tigm) IST14843A4 (tigm) IST10382C11 (tigm) IST14277E8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000036350
Sequence
GCTTCACGAGGCAGCCCCCACTACAGTAAGGAAGGTGTGGGTAGTTCCGGGTCCCAGGCTCAGCATGCGGTGCATCAGTCCAACTGCTCTGGTGACCTTT

TGCGCCGGGTTTTGTATCTCGAACCCTGTGCTGGCGCAGGGCCTGGAGGCCGGTGTGGGGCCGAGGGCTGACTGTGAAG - UNI31080 - TATGTAA

AGAATTCTTAGACCGATTCTACAACTCCCTGCTAAGCAGAGGCATAGACTTTTCTGCGGACACCATAGAGAAAGAGCTGCTCAACTTTTGCTCAGATGCC

AAAGGAAAAGAAAACCGCCTG TGCTATTATCTGGGGGCCACCACAGATGCAGCCACCAAGATCCTAGGAGAAGTCACTCGTCCCATGAGTGTACACATA

CCTGCCGTGAAGATTTGTGAGAAGCTAAAGAAGATGGACAGCCAGATCTGTGAGCTGAAATACG GGAAGAAGCTGGACTTGGCGTCGGTGGACCTGTGG

AAGATGAGAGTGGCAGAGCTAAAGCAGATCCTTCAGAGATGGGGGGAAGAGTGCAGGGCATGTGCGGAGAAAAGTGACTACGTGAACCTCATTAGAGAGC

TGGCCCCCAAATATGTAGAGATATACCCCCAAACGGAGCTCTGACCCCGTCGGCTGTCAGGAAGCATGGACTGCAGTTAGAAGAAAATGACTGTCTAAGA

TGAGAGTGTGCTGGTTAGGGCTAACCAGGGACTGCCCAGTTGGCCGTCAGTTTTGCTGTTGTATTGTGGAGTTGTGTTGTTTAGGCATATGATCAACCCG

TGCTTCCTCATGGTCGCTAAAATTGCAGAGCACAGAGACCTCAAGGTGCTTTTCTCATCCTTCTTGGAGGATGCAGTGGTTGCCTTTGCATTGCTATGAC

AATAATGCTTATTGAGAGAGGCTGGCCATGGCCACATGGAGAGAGGGGGAAGGGAGTGAGAGAAAGAGGGCTAGAGATGAGAGTAAGAAAGGTGAGGGCT

TAAAGAGAGAGAGGAAGGGCCAAGCAGCCCCCTTTATAGTGGGCTGGGCTACCTTGCTGTTGCCAGGTAACTGAAACAAGTGTGGGGAGGGAAGAGTCAC

TTGGGCTCAGGGATTTGGTCCATCACAGCAGGGTAGCTAAGGGCAGCACAGCTCAGAGCAGGGCGACAAGAGCTTGTCATAGAGGCTGTTGTGATTATAG

AGAGGCAGAAAGTGATGTCCAAATAATGATAAGGCTGTAACCTTCAAAGGGATAGCCCTATTCATCCACTTCTGTCAGTCAGACACCCACCTCACAGTTT

CCCCAAATTACCACTAGCTAGGGAACAAACCTTCAAATCAAACCGATGCCAGGTGTGGTGGTGAATGCCTTTAATGCCAGCACTCTGTCTGGAGGCAGAT

CTCTGTGAGTCTGAGGCCAGCCTGGTCTACAAAGTGAGTCTAGGACAGCCAGGGTCACACAGAGAAACACTGTTTTGAAAAACAAACAAACAAACAAACA

AACAGACAAACACTAAAATAAAATCCAACCAATGAACCAACCAAACAACCAAACAACCCAAACCAAACAAAAAACTGAGCTGGAGGAGGACAGTTCAGAT

CCAAGGCACAGCAGAAGGACAATGTAGTTTATCACTACTGACTCAAGTGTGCTATGGATATGATGGGATAATACATTTTAAGGAAGGAAAGAGACAAGAG

GCATCTCTTTGGTCAAGGTTTTTAAAAAGAGTGCATAACAGAAACTATAGCTTATCTAATGTGCGACTTCAATCTCAATAACCACCTAACATAGTTCAGA

AGGTTCTTGTTTCATTTTGCTTTTTAAAAATAGATTTTTTAAAAAACTTCATTCACTCTAAATATTTTCTCTCTTTTGCACAGCAAGGAGGGAAGCATTC

ATTACTTTATAGGCTCTTGAGACAAAATACCTAAAAAAACAATCGAGAAAGGAGTTAATTTAGTTCATGGTTTGAGATTACAGTTCATCACGGCAGCAGG

AGTGTGAGGCCATTGGTCAAACTCATCCATGTCCTAGAAGCAGAGATGGAAGTAGATGCTCTGCTAGCTGTCAGTCTGACCCCAGCACGGGAATGCCACT

GCTCACATTCAGGATGGGGTCTTCCTTCCACAGTTAAACTCTCTCTAGCAACGCCCTCCCACTCGTGCCCAGAGGTATGTGTCACCTAGGCAATTCTAAA

TTCCACCAAGTTAACAATGGCGATTAAGCATTGCACAGCACGAATGGAAGTTTCCGTTTCTCATATAAAGAAAACTGATCGGAAGAATACAAATCAGCAA

TCCATAAAAAGTCTGTGCTTGGCCTATTTATAACTACCTTTTTTTGTTGTTGTTTTTTGTTTTTTGTTTTTTTGTTTTTTTGTTTTCTTGAAGCAGGATT

TCTCTGTATAGTTCTGGCTGTCCTGGAACTCACTCTGTAGACCAGGCTGGCCTCAAACTCAGAAATCCGCCTGCCTCTGCTGGGATTAAAGGCGTGCGCC

ACCACGCCCGGCTTGTAACCACCTTGAATTGCCACGTGACCCAAGCTCAGAGTCTTCTTCACTGCCCCGTGTCAGGCAGGATGAAAGCATGCTCCCCACG

TGCAGGCAGCAGGGGCGCTTGTGGTTTCTAATGCTAGCCTATCAGTCTTAAGAAGCAGGCAATGTTTCAGCTCCATTCTCTGTCCATAGATCAATAAGAA

GCACATGGTTAAATGGTTGCCTTTGGGAAATAGGTCAGGGTGTGGCTACTCAAGAAAGCATTCTCTTTAAAGTTTCTGGGGTGATGGGACTGTACTTTAT

CAAGGCAGGAGGTGAGAGATATGATCATCATATTGATATAGAGGTACAATTAAGATGTGGGTATTCTATTGTACATCAATTCTATTTCATAAAAAGTTGT

AGGAGCTATTTGAAAATTACCCAAAATTAATTGATTAAAAGCAACTGTTCTTTTAAATAATCAAATGTACTCATAGCCATCTTTTTTGTAGAGTAGAGAA

TAACTTAAATTCAGATAATAAATATACATTG
Translation
MRCISPTALVTFCAGFCISNPVLAQGLEAGVGPRADCEV - UNI31080 - VCKEFLDRFYNSLLSRGIDFSADTIEKELLNFCSDAKGKENRL CYY

LGATTDAATKILGEVTRPMSVHIPAVKICEKLKKMDSQICELKYG GKKLDLASVDLWKMRVAELKQILQRWGEECRACAEKSDYVNLIRELAPKYVEIY

PQTEL

For any suggestions or comments, please send an email to unitrap@crg.es