Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000039501 (Znfx1)
Chromosomal location
Chr 2: 166861299 - 166888515 (-)
Description
zinc finger, NFX1-type containing 1 Gene [Source:MGI (curated);Acc:Znfx1-001]
RefSeq_dna
NM_001033196 
RefSeq_peptide
NP_001028368.2 
UniGene
Mm.297074 
MGI
MGI:2138982 
Uniprot/SWISSPROT
Q8R151 
Uniprot/SPTREMBL
A2A5R3 A2A5R4 A2A5R5 A2A5R6 
Human Ortholog
ENSG00000124201 (ZNFX1)
Omim not available
UniTrap UNI23471
Vector Insertion
Chr 2: 166885643 - 166888009
Public Clones (sanger)
Private Clones OST258197 (lexicon) OST195417 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28258
Vector Insertion
Chr 2: 166882442 - 166885531
Public Clones (sanger) E021B08 (ggtc) IST10925H4 (tigm) IST13000G12 (tigm)
Private Clones OST35865 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9661
Vector Insertion
Chr 2: 166875946 - 166880653
Public Clones XG521 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9781
Vector Insertion
Chr 2: 166874082 - 166875813
Public Clones XH664 (baygenomics) A056F03 (ggtc) A019C05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 35% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1729
Vector Insertion
Chr 2: 166865770 - 166867193
Public Clones CG0425 (sanger)
Private Clones OST433085 (lexicon)
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4139
Vector Insertion
Chr 2: 166865373 - 166865658
Public Clones AN0241 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000048988
Sequence
TTCCGCGCCATGTCGCGCTTGGCACGCACGAGCCGCCCGCCGCGTCCCCCTGGCTCCGGGGCCAGCCGAGACCTGCGGCCGCCCGGGGCGCAGTCAACCC

GCCCCCCGCCGCGCCCTCCCCTCCGCCGCGCCCGCGGGGAGCCGCCAGTCCAGCCGCCGCCGCTACCGCGGGCGCTGAGGCGACGCCGCCCTTCCGCCCG

CCCCGAGGGCGGGGGCGCAGGCGAGCCCGGCCTCTCGCTGGAGCCCGCGGCACCGCCTCCTCGTCCTGCGCGGCCTCCTCTTCCTCCGGGCCGCCCACTA

GGCTACTCGCCCCGCCCAGGGGCTGCAGGGACTGGAAACCGAAAGTTCGCGGTGCCGGGCGGGGCCGCGACCTGCCAGGGCCGGGGCTGAGCTCTAGCCC

TGCGGAGGACGCGCCCGAGCCGGTGAGTGGCCTCCGCCCTATCACGCACCTGCTTCTGCGGCGCTGCGACCGCCGGCGTCCCGCTCTGCCTCCGGCCGGG

TGTCAG - UNI23471 - TTACAGGTAACGAAGTCAGGCGAAGGTGGCAGAATTCGTGAGACTCAGCTATGGAAGACAGAAGACCTCATCTAGAGGCC

AGGCCCAGGAATCCGCCTGCCAACCACAGAG - UNI28258 - GTCCTATGGATGGAGAATTGCCACCAAGAGCTAGAAACCAGACCAATAACCCAGC

AGCCACCAACCATGCTGGAAGGCATCTGAGGGCCAGCAACCATCCTGCTCCTTTCCGACAGAGGGAAGAGAGATTTAGGGCTATGGGCAGGAACCCACAT

CAGGGAAGAAGAAACCAGGAAGGGCATACCAGTGACGAAGCTAGAGACCAGAGACAAAGCCAGAATGACACCAGGAGGAGGAATGACGACCAGGAAGGTA

GGAGCCACAGACCACCATGGTCCAGCGACACTTTCCAGCAGTGGCACACCCCACCCCAGAAGCCAGGAGAGCAGCCACAGCAGACCAAGAGACTGGGCTA

CAAGTTCCTGGAGAGCCTCCTGCAGAAGGAGCCCTCTGAGGTGGCCATCACGCTTGCCACAAGCCTAGGGCTCAAGGAACTGCTTTCTCATTCCTCCATG

AAGCCCAGCTTCCTTCAGCTGATCTGCCAAGTTCTCCGGAAGGCGTGCAGCTCCCGGATAGACCGTCAGAGCATCCTGCATGTGCTGGGCATCCTGAACA

ACTCCAAGTTCCTCCGAGTCTGCCTGCCAGCTTACGTGGTGGGGATGATCACGGAGCCCAGCCCCGACATTCGGAACCAGTACCCAGAACACATAAGCAA

TATCATCTCCCTCCTCCAGGACCTCGTCAGTGTCTTCCCTGCCAGCTCTATGCAGGAAACCTCCATGCTCATCTCTCTCCTGCCGACTTCTCTTAATGCT

TTGAGAGCCTCTGGGGTTGACATAGAAGAGGAGACAGAGAAGAACCTGGAAAAGGTACAGGCTATCATTAAGTATCTGCAGGAAAAGAGGCGCCAGGGCA

GTCTGAGAGTAGACACCTACACTCTAGTGCAGGCTGAGGCGGAAGGGGAGGTTGAGAGCTACCGGGCCATGCCCATCTACCCCACCTACAACGAGGTGCA

CCTAGATGAGAAGCCCTTCCTTCGCCCCAACATCATTTCCGGGAAATACGAGAGCACTGCTGTCTACCTCGACACTCACTTCCGCCTCCTGCGAGAGGAT

TTTGTTAGGCCCCTTCGGGAAGGCATTTTGAAGCTTCTACAAAGCTTCGAGGACCAGTGTCTGAGGAAGAGGAAGTTCGATGACATCCGAATCTACTTTG

ACGCTAGGATCATCACCCCGATGTGCTCAGCCTCTGGCATCGTGTACAAAGTGCAGTTTGACACCAAGCCGCTCAAGCTTGTTCGCTGGCAGAATTCCAA

GCGACTGCTGTATGGGTCCTTAGTGTGCATGTCCAAGGACAACTTCGAGACGTTTCTTTTTGCCACCGTTTCAAACCGAGAGCACGAAGATCTCTGCCAA

GGGATTGTCCAGCTGTGCTTCAACGAGCAGAGCCAGCAGCTGCTGGCTGACGTTCAGCCCTCTGACTCTTTCCTCATGGTGGAGACAACAGCCTACTTTG

AGGCTTATCGGCATGTCCTGGAAGGGCTACAAGAGGTCCAGGAAGAAGATGTCCCCTTCCAGAGGAACATTGTGCAGTGTGACTCCTATGTGAGGAACCC

GAGGTACTTGCTAATGGGTGGCAGATATGACTTCACCCCCCTCATGGAGAATCCCTCAGCCATGAGGAAGTCTCTGAGAGGTGCTGAGGCTTTGAGACAT

CCTAGGATTAATGTCTTTGACTTTGGCCAATGGCCCTCCAAAGAAGCCCTGAAGCTGGATGACTCCCAGATGGAAGCCTTACAGTTCGCCCTCACCAAGG

AGCTGGCTATCATTCAAGGACCTCCTGGAACAG - UNI9661 - GCAAGACTTACGTGGGTCTAAAAATTGTTCAGGCTCTTCTGACCAATAAGTCTG

TTTGGCAAATTAATACCCAGACATTCCCCATCTTGGTGGTGTGTTATACCAATCATGCTTTGGACCAGTTTCTGGAAG - UNI9781 - GCATCTACG

GGTGTCAGAAGACCAGCATTGTGCGAGTGGGCGGAAGGAGCAACAGTGAAATCCTGAAGCAGTTCACCCTGAGGGAGCTGAGGAACAAGCGGGAGTTCCG

CCGCACCCTGCCCATGCACCTGCGGAGGGCCTATATGAGT ATTGTGACAGAGATGAAGGAGTCAGAGCAAAAACTTCAGGAAGGGGCCCAGACCCTGGA

ATGCACCATGCACGGTGTCCTTCGGGAGCAGCACCTGGAGAAGTACATCTCTGCCCAGCACTGGGAAAGCCTCATGAGTGGGCCCGTGCAG GATGCTGA

CTGGGTCTGTGTGCAGCCCTCGAAGCACTCCATGATTCTTGAATGGCTGGGGCTTGGTGTGGGCTCCTTCACTCAGAGTGCATCTCCAGCAGGACCTGAG

AACACAG CCCAGGCAGAGGGGGAAGAGGAGGAGGAAGGGGAAGAGGAGGGTTCCCTAATCGAGATTGCGGAAGAAGCCGACCTGATCCAAGCGGACAGA

GTGATTGAAGAGGAGGAGGTGGTGAGACCTCGAAGAAGAAAGAAGGAAGAGAACGGAACCGACCAGGAGCTGGCTAAAATGCTGTTGGCCATGAGACTGG

ACCAGGAAGTGCCTGGGACTACAGCTGGACCAGAACAAGCTACAGAAGAGTGGGAG ACTCAGCGTGGCCAGAAAAAGAAGATGAAGAGGAGAGTGAAGG

TGGAGCTTCGCAAACTGAATACCATGACCAAGGCCGAGGCCAATGGGATCCAGGACGTCTGGCAGCTGGACCTGAGCTCCCGCTGGCAGCTCTATAG GC

TGTGGCTGCAGATGTACCAAGCCGACACTCGCCGGAGGATCCTCAGCTATGAACGCCAGTACCGCACATGGGCAGAAAGAATGGCCGAGCTGAGACTCCA

GGAAGACCTTCACATCCTCAAAGATGCCGAAGTTGTGGGCATGACAACCACAG GTGCTGCCAAGTACCGCCAGATCCTTCAGCAAGTGGAGCCTCGGAT

CGTCATTGTAGAAGAGGCTGCTGAGGTCCTTGAGGCCCACACCATCGCCACACTAAGCAAAGCTTGCCAGCATCTTATTCTGATTGGGGACCACCAGCAG

 - UNI1729 - CTGCGCCCCAGTGCTAATGTGTATGATCTGGCCAAGAACTTCAACCTTGAGGTGTCCCTGTTTGAACGGCTGGTAAAAGTGAACATC

CCCTTTGTCCGTCTGAATTACCAG - UNI4139 - CACCGCATGCGCCCTGAAATCGCCCGCCTTTTGACCCCCCACATTTACCAGGATCTGGAGAAC

CATCCTTCTGTTCTCAAGTATGAGCAGATTAAG GGTGTCTCCTCCAACCTTTTCTTTGTGGAGCACAACTTTCCTGAGCAGGAGATCCAAGAAGGCAAA

AGTCACCAGAACCAGCATGAGGCACACTTTGTGGTGGAGCTGTGCCAGTACCTCCTGTGCCAGGAGTACCTGCCCTCCCAGATCACCATCCTCACCACCT

ACACTGGGCAGCTCTTCTGTTTGCGCAAACTCATGCCTGTCAAGACGTTTGCTGGCATCAAGGTCCATGTGGTGGACAAGTACCAAGGGGAAGAGAATGA

CATCATTCTCCTCTCACTGGTGCGGAGCAACCAAGAGGGCAAGGTGGGCTTCCTGCAGATCCCCAACCGCATCTGCGTAGCCTTGTCCCGGGCCAAGAAG

GGGATGTACTGCATTGGGAACATGCAGATGCTTGCCAAGGTGCCCTTGTGGAGCAGGATCATCCATACCCTTCGAGAGAACAACCAGATAGGCCCGTCCC

TCCGCCTCTGTTGCCAGAACCACCCTGAGACCCACACCCTTGTATCCAAAGCTTCTGACTTCCAGAAAGTACCGGAAGGAGGCTGCAGCCGGCCCTGTGA

GTTCCGGTTGGCCTGTGGTCATGTGTGCACACGTGCCTGCCATCCATATGACTCCTCCCACAAGGAGTTCCAGTGCATGAAGCCATGCCAGAAAGTCCTC

TGCCAGGATGGGCACCGGTGCCCAAATGTCTGCTTCCAAGAGTGTCAGCCTTGTCAGGTGAAAGTGCCCAAAATCATTCTGAAGTGTGGTCACAAACAGA

TGGTCCCTTGTTCAATGTCAGAGTCAGAGTTTTGTTGCCAGGAGCCTTGCTCCAAGATACTAAGATGTGGTCACAGATGCAGCCATCTCTGTGGTGAGGA

TTGTGTGCGGCTGTGTTCAGAAAGGGTCACCGTGGAACTTAAATGTGGGCACAGTCAACTGGTTAAGTGTGGCAATGTGGAAGATATAAAATATGGTCTG

CCAGTCAAGTGTACCACCAAGTGTGACACTACTCTAGATTGCGGCCATCCCTGCCCAGGCTCCTGTCACAGCTGTTTTGAAGGGCGCTTCCATGAGCGCT

GTCAACAGCCATGTAAGCGCCTGCTCATCTGCTCACACAAGTGCCAGGAGCCCTGCACTGGTGAGTGCCCACCCTGCCAGCGAACATGTCAGAACCGCTG

TGTCCACAGCCAGTGCAAGAAGAAGTGTGGGGAGCTGTGCAGCCCCTGCGTGGAGCCCTGCGTCTGGCGCTGCCAGCACTACCAGTGCACCAAACTCTGC

TCAGAGCCCTGCAACCGGCCCCCATGCTACGTGCCTTGTACCAAGCTGCTGGCTTGTGGCCACCCTTGCATCGGTCTGTGTGGGGAGCCATGTCCCAAGA

AGTGCCGTGTCTGCCAACCAGATGAAGTCACCCAAATCTTTTTTGGCTTTGAGGATGAGCCTGATGCCCGCTTTGTGCAGCTAGAAGACTGCAGCCACAT

CTTTGAAGTGCAAGCCTTGGACCGCTTCATGAATGAGCAGAAGGATGATGAAGTTGCCATCAAGTTGAAAGTCTGCCCCATCTGTCAGGTACCCATCCGC

AAAAACCTGAGGTATGGAACCAGCATCAAACAGCGGCTGGAAGAGATCGAGATTGTCAAGGAGAAGATCCAGGGCTCTGCAGGGGAGATTTCAACCAGCC

AGGAACAACTTAAGGCCCTGCTGAAGAGCAAGACCCTCTTCCATCAGCTGCGTCCTGAAGAATTCCTAATACTTCAAGAGAAGCTGGCCCAGAAAAACCT

GTCAGTGAAGGACCTGGGCCTGGTGGAGAATTCTATCCGCTTCTATGACCACTTGGCCAACCTGGAGGGGTCACTGGAGAAGGTGCATTGTGGAGAACAG

CAGAGCGTGAGGACTCGACTTGAGCAGGTCCACGAGTGGCTGGCCAAGAAGCGCCTGAGCTTCAGCAGCCAGGAACTGAGTGACCTCCAGAGTGAAATCC

AGAGGCTCACCTATTTGGTGAACCTCCTGATGCGCTGCAAGATGGCCGAGAAGGTGAAAGGCAGCATAGCAGAAGAGGTCTCCAGCATCCGGAACATTCT

TGAAAAGACAAGTAAGTTCACCCAGGAAGATGAACAGCTTGTGCAGAAAAAGATGGATGCTCTGAAAACCACCCTTCCCTGCTCTGGCTTGGGCATCTCA

GATGAGGAACGAGTGCAGATTGTCACTGCCATGGGTGTTCCTCGTGGGCATTGGTTCAAGTGCCCCAATGGCCACATCTATGTAATTACTGAGTGTGGGG

GCGCCATGCAAAGGAGTACCTGTCCCGAGTGTCAGGAGGTGATCGGTGGGGAGAATCACACTCTAGAGAGGAGCAACCACCTGGCCTCTGAGATGGATGG

AGCCCAGCACCCTGCCTGGTCGAACACAGCCAACAACTTCATGAACTTTGAGGAGATCCACAGGATGATGTAGAAGATGGCACCTCAAGGCCTTTTGCCC

TGCCACCTCAGAGCCAGGGTTGGCTCCTCCATGGAGGAACCAGTTTATTAGTGTCCTTTAGTCTTCGCACTTGTCTAAGGATCCACTTTTAGGGCTTGCC

CACATGTGATTCTATATGTACCCTGCGCTAGAGTAAGCACTTTACCCCCAGCACTGAGCAGAGCCCACAGTTCTCAGCTCCTCGACTGTAGCAAGTAGGA

CTGACTCCTGGGAGCTTCCGGCCTCCACCCGGGGATATTAGGGTGATTGGGTCCTGGCATGGCCAGCACTTCTGCGCGTGCCCAGGGTGCACTGCTTCTC

ATGTCCAGGCCCTAACTTGCATACTACCATTGTAATAACAGCAACCCAGAGAGAGCTTTAGGAACCACTTTACCTTCAAGGAGCACAAGAACCCAGGCAC

CCTACTCCTTGGGCTCCTGCCCTCCTGGAGATGGAGGCCTGTGACAGGCACTTCAACTCTCCATGGCCCAGTTATATACTCACTGTCCCCAGTGGGGCGG

GGCTTTCACAGCAGACACAAGCTGAGTGACCCCTGCACCCTCGTCAAACTTGCACTCAGATAGCAGGGGTGGATGTGTCTCTCTGCAGGAGAGGTTCTGT

GGTGGTGGTGGTGTCAGCAGGTTCAGTGTCAGCAGCACCTCCTGTGAGTCTTTATCCAGGCACCCTCCCTTGCAGCCTTTGCCTGGGTAGGGTTAGCATG

CCAGCAGCTTCTGCAGGCCCCGACTCCAGGCCTACTGCCTGCATCTGCATCTCTTTCCATGTTCCTTAGAACAGATTTAGGCATCTCAGGTCCTTTCTAA

TGTTGTCTAGGAAAGCCCCTTTCTTATTGTATGCATTTCCTTTTTTTGTCTTTACTATGCACTTTAACCTATAAAGCCAATTAATAAAAACAATGATTG
Translation
 - UNI23471 - MEDRRPHLEARPRNPPANHRG - UNI28258 - GPMDGELPPRARNQTNNPAATNHAGRHLRASNHPAPFRQREERFRAMGRNP

HQGRRNQEGHTSDEARDQRQSQNDTRRRNDDQEGRSHRPPWSSDTFQQWHTPPQKPGEQPQQTKRLGYKFLESLLQKEPSEVAITLATSLGLKELLSHSS

MKPSFLQLICQVLRKACSSRIDRQSILHVLGILNNSKFLRVCLPAYVVGMITEPSPDIRNQYPEHISNIISLLQDLVSVFPASSMQETSMLISLLPTSLN

ALRASGVDIEEETEKNLEKVQAIIKYLQEKRRQGSLRVDTYTLVQAEAEGEVESYRAMPIYPTYNEVHLDEKPFLRPNIISGKYESTAVYLDTHFRLLRE

DFVRPLREGILKLLQSFEDQCLRKRKFDDIRIYFDARIITPMCSASGIVYKVQFDTKPLKLVRWQNSKRLLYGSLVCMSKDNFETFLFATVSNREHEDLC

QGIVQLCFNEQSQQLLADVQPSDSFLMVETTAYFEAYRHVLEGLQEVQEEDVPFQRNIVQCDSYVRNPRYLLMGGRYDFTPLMENPSAMRKSLRGAEALR

HPRINVFDFGQWPSKEALKLDDSQMEALQFALTKELAIIQGPPGTG - UNI9661 - GKTYVGLKIVQALLTNKSVWQINTQTFPILVVCYTNHALDQ

FLEG - UNI9781 - GIYGCQKTSIVRVGGRSNSEILKQFTLRELRNKREFRRTLPMHLRRAYMS IVTEMKESEQKLQEGAQTLECTMHGVLREQHL

EKYISAQHWESLMSGPVQ DADWVCVQPSKHSMILEWLGLGVGSFTQSASPAGPENTA AQAEGEEEEEGEEEGSLIEIAEEADLIQADRVIEEEEVVRP

RRRKKEENGTDQELAKMLLAMRLDQEVPGTTAGPEQATEEWE TQRGQKKKMKRRVKVELRKLNTMTKAEANGIQDVWQLDLSSRWQLYR RLWLQMYQA

DTRRRILSYERQYRTWAERMAELRLQEDLHILKDAEVVGMTTTG GAAKYRQILQQVEPRIVIVEEAAEVLEAHTIATLSKACQHLILIGDHQQ - UNI

1729 - LRPSANVYDLAKNFNLEVSLFERLVKVNIPFVRLNYQ - UNI4139 - HRMRPEIARLLTPHIYQDLENHPSVLKYEQIK GVSSNLFFVE

HNFPEQEIQEGKSHQNQHEAHFVVELCQYLLCQEYLPSQITILTTYTGQLFCLRKLMPVKTFAGIKVHVVDKYQGEENDIILLSLVRSNQEGKVGFLQIP

NRICVALSRAKKGMYCIGNMQMLAKVPLWSRIIHTLRENNQIGPSLRLCCQNHPETHTLVSKASDFQKVPEGGCSRPCEFRLACGHVCTRACHPYDSSHK

EFQCMKPCQKVLCQDGHRCPNVCFQECQPCQVKVPKIILKCGHKQMVPCSMSESEFCCQEPCSKILRCGHRCSHLCGEDCVRLCSERVTVELKCGHSQLV

KCGNVEDIKYGLPVKCTTKCDTTLDCGHPCPGSCHSCFEGRFHERCQQPCKRLLICSHKCQEPCTGECPPCQRTCQNRCVHSQCKKKCGELCSPCVEPCV

WRCQHYQCTKLCSEPCNRPPCYVPCTKLLACGHPCIGLCGEPCPKKCRVCQPDEVTQIFFGFEDEPDARFVQLEDCSHIFEVQALDRFMNEQKDDEVAIK

LKVCPICQVPIRKNLRYGTSIKQRLEEIEIVKEKIQGSAGEISTSQEQLKALLKSKTLFHQLRPEEFLILQEKLAQKNLSVKDLGLVENSIRFYDHLANL

EGSLEKVHCGEQQSVRTRLEQVHEWLAKKRLSFSSQELSDLQSEIQRLTYLVNLLMRCKMAEKVKGSIAEEVSSIRNILEKTSKFTQEDEQLVQKKMDAL

KTTLPCSGLGISDEERVQIVTAMGVPRGHWFKCPNGHIYVITECGGAMQRSTCPECQEVIGGENHTLERSNHLASEMDGAQHPAWSNTANNFMNFEEIHR

MM
Transcript ENSMUST00000067584
Sequence
ATGGCTGCAGTAATTTTCACCTTAGCGTCTGTCTGTGCCTTACTGGCTCAG ACTCAGCGTGGCCAGAAAAAGAAGATGAAGAGGAGAGTGAAGGTGGAG

CTTCGCAAACTGAATACCATGACCAAGGCCGAGGCCAATGGGATCCAGGACGTCTGGCAGCTGGACCTGAGCTCCCGCTGGCAGCTCTATAG GCTGTGG

CTGCAGATGTACCAAGCCGACACTCGCCGGAGGATCCTCAGCTATGAACGCCAGTACCGCACATGGGCAGAAAGAATGGCCGAGCTGAGACTCCAGGAAG

ACCTTCACATCCTCAAAGATGCCGAAGTTGTGGGCATGACAACCACAG GTGCTGCCAAGTACCGCCAGATCCTTCAGCAAGTGGAGCCTCGGATCGTCA

TTGTAGAAGAGGCTGCTGAGGTCCTTGAGGCCCACACCATCGCCACACTAAGCAAAGCTTGCCAGCATCTTATTCTGATTGGGGACCACCAGCAG - UN

I1729 - CTGCGCCCCAGTGCTAATGTGTATGATCTGGCCAAGAACTTCAACCTTGAGGTGTCCCTGTTTGAACGGCTGGTAAAAGTGAACATCCCCTT

TGTCCGTCTGAATTACCAG - UNI4139 - CACCGCATGCGCCCTGAAATCGCCCGCCTTTTGACCCCCCACATTTACCAGGATCTGGAGAACCATCC

TTCTGTTCTCAAGTATGAGCAGATTAAG GGTGTCTCCTCCAACCTTTTCTTTGTGGAGCACAACTTTCCTGAGCAGGAGATCCAAGAAGGCAAAAGTCA

CCAGAACCAGCATGAGGCACACTTTGTGGTGGAGCTGTGCCAGTACCTCCTGTGCCAGGAGTACCTGCCCTCCCAGATCACCATCCTCACCACCTACACT

GGGCAGCTCTTCTGTTTGCGCAAACTCATGCCTGTCAAGACGTTTGCTGGCATCAAGGTCCATGTGGTGGACAAGTACCAAGGGGAAGAGAATGACATCA

TTCTCCTCTCACTGGTGCGGAGCAACCAAGAGGGCAAGGTGGGCTTCCTGCAGATCCCCAACCGCATCTGCGTAGCCTTGTCCCGGGCCAAGAAGGGGAT

GTACTGCATTGGGAACATGCAGATGCTTGCCAAGGTGCCCTTGTGGAGCAGGATCATCCATACCCTTCGAGAGAACAACCAGATAGGCCCGTCCCTCCGC

CTCTGTTGCCAGAACCACCCTGAGACCCACACCCTTGTATCCAAAGCTTCTGACTTCCAGAAAGTACCGGAAGGAGGCTGCAGCCGGCCCTGTGAGTTCC

GGTTGGCCTGTGGTCATGTGTGCACACGTGCCTGCCATCCATATGACTCCTCCCACAAGGAGTTCCAGTGCATGAAGCCATGCCAGAAAGTCCTCTGCCA

GGATGGGCACCGGTGCCCAAATGTCTGCTTCCAAGAGTGTCAGCCTTGTCAGGTGAAAGTGCCCAAAATCATTCTGAAGTGTGGTCACAAACAGATGGTC

CCTTGTTCAATGTCAGAGTCAGAGTTTTGTTGCCAGGAGCCTTGCTCCAAGATACTAAGATGTGGTCACAGATGCAGCCATCTCTGTGGTGAGGATTGTG

TGCGGCTGTGTTCAGAAAGGGTCACCGTGGAACTTAAATGTGGGCACAGTCAACTGGTTAAGTGTGGCAATGTGGAAGATATAAAATATGGTCTGCCAGT

CAAGTGTACCACCAAGTGTGACACTACTCTAGATTGCGGCCATCCCTGCCCAGGCTCCTGTCACAGCTGTTTTGAAGGGCGCTTCCATGAGCGCTGTCAA

CAGCCATGTAAGCGCCTGCTCATCTGCTCACACAAGTGCCAGGAGCCCTGCACTGGTGAGTGCCCACCCTGCCAGCGAACATGTCAGAACCGCTGTGTCC

ACAGCCAGTGCAAGAAGAAGTGTGGGGAGCTGTGCAGCCCCTGCGTGGAGCCCTGCGTCTGGCGCTGCCAGCACTACCAGTGCACCAAACTCTGCTCAGA

GCCCTGCAACCGGCCCCCATGCTACGTGCCTTGTACCAAGCTGCTGGCTTGTGGCCACCCTTGCATCGGTCTGTGTGGGGAGCCATGTCCCAAGAAGTGC

CGTGTCTGCCAACCAGATGAAGTCACCCAAATCTTTTTTGGCTTTGAGGATGAGCCTGATGCCCGCTTTGTGCAGCTAGAAGACTGCAGCCACATCTTTG

AAGTGCAAGCCTTGGACCGCTTCATGAATGAGCAGAAGGATGATGAAGTTGCCATCAAGTTGAAAGTCTGCCCCATCTGTCAGGTACCCATCCGCAAAAA

CCTGAGGTATGGAACCAGCATCAAACAGCGGCTGGAAGAGATCGAGATTGTCAAGGAGAAGATCCAGGGCTCTGCAGGGGAGATTTCAACCAGCCAGGAA

CAACTTAAGGCCCTGCTGAAGAGCAAGACCCTCTTCCATCAGCTGCGTCCTGAAGAATTCCTAATACTTCAAGAGAAGCTGGCCCAGAAAAACCTGTCAG

TGAAGGACCTGGGCCTGGTGGAGAATTCTATCCGCTTCTATGACCACTTGGCCAACCTGGAGGGGTCACTGGAGAAGGTGCATTGTGGAGAACAGCAGAG

CGTGAGGACTCGACTTGAGCAGGTCCACGAGTGGCTGGCCAAGAAGCGCCTGAGCTTCAGCAGCCAGGAACTGAGTGACCTCCAGAGTGAAATCCAGAGG

CTCACCTATTTGGTGAACCTCCTGATGCGCTGCAAGATGGCCGAGAAGGTGAAAGGCAGCATAGCAGAAGAGGTCTCCAGCATCCGGAACATTCTTGAAA

AGACAAGTAAGTTCACCCAGGAAGATGAACAGCTTGTGCAGAAAAAGATGGATGCTCTGAAAACCACCCTTCCCTGCTCTGGCTTGGGCATCTCAGATGA

GGAACGAGTGCAGATTGTCACTGCCATGGGTGTTCCTCGTGGGCATTGGTTCAAGTGCCCCAATGGCCACATCTATGTAATTACTGAGTGTGGGGGCGCC

ATGCAAAGGAGTACCTGTCCCGAGTGTCAGGAGGTGATCGGTGGGGAGAATCACACTCTAGAGAGGAGCAACCACCTGGCCTCTGAGATGGATGGAGCCC

AGCACCCTGCCTGGTCGAACACAGCCAACAACTTCATGAACTTTGAGGAGATCCACAGGATGATGTAGAAGATGGCACCTCAAGGCCTTTTGCCCTGCCA

CCTCAGAGCCAGGGTTGGCTCCTCCATGGAGGAACCAGTTTATTAGTGTCCTTTAGTCTTCGCACTTGTCTAAGGATCCACTTTTAGGGCTTGCCCACAT

GTGATTCTATATGTACCCTGCGCTAGAGTAAGCACTTTACCCCCAGCACTGAGCAGAGCCCACAGTTCTCAGCTCCTCGACTGTAGCAAGTAGGACTGAC

TCCTGGGAGCTTCCGGCCTCCACCCGGGGATATTAGGGTGATTGGGTCCTGGCATGGCCAGCACTTCTGCGCGTGCCCAGGGTGCACTGCTTCTCATGTC

CAGGCCCTAACTTGCATACTACCATTGTAATAACAGCAACCCAGAGAGAGCTTTAGGAACCACTTTACCTTCAAGGAGCACAAGAACCCAGGCACCCTAC

TCCTTGGGCTCCTGCCCTCCTGGAGATGGAGGCCTGTGACAGGCACTTCAACTCTCCATGGCCCAGTTATATACTCACTGTCCCCAGTGGGGCGGGGCTT

TCACAGCAGACACAAGCTGAGTGACCCCTGCACCCTCGTCAAACTTGCACTCAGATAGCAGGGGTGGATGTGTCTCTCTGCAGGAGAGGTTCTGTGGTGG

TGGTGGTGTCAGCAGGTTCAGTGTCAGCAGCACCTCCTGTGAGTCTTTATCCAGGCACCCTCCCTTGCAGCCTTTGCCTGGGTAGGGTTAGCATGCCAGC

AGCTTCTGCAGGCCCCGACTCCAGGCCTACTGCCTGCATCTGCATCTCTTTCCATGTTCCTTAGAACAGATTTAGGCATCTCAGGTCCTTTCTAATGTTG

TCTAGGAAAGCCCCTTTCTTATTGTATGCATTTCCTTTTTTTGTCTTTACTATGCACTTTAACCTATAAAGCCAATTAATAAAAACAATGATTG
Translation
MAAVIFTLASVCALLAQ TQRGQKKKMKRRVKVELRKLNTMTKAEANGIQDVWQLDLSSRWQLYR RLWLQMYQADTRRRILSYERQYRTWAERMAELRL

QEDLHILKDAEVVGMTTTG GAAKYRQILQQVEPRIVIVEEAAEVLEAHTIATLSKACQHLILIGDHQQ - UNI1729 - LRPSANVYDLAKNFNLEV

SLFERLVKVNIPFVRLNYQ - UNI4139 - HRMRPEIARLLTPHIYQDLENHPSVLKYEQIK GVSSNLFFVEHNFPEQEIQEGKSHQNQHEAHFVVE

LCQYLLCQEYLPSQITILTTYTGQLFCLRKLMPVKTFAGIKVHVVDKYQGEENDIILLSLVRSNQEGKVGFLQIPNRICVALSRAKKGMYCIGNMQMLAK

VPLWSRIIHTLRENNQIGPSLRLCCQNHPETHTLVSKASDFQKVPEGGCSRPCEFRLACGHVCTRACHPYDSSHKEFQCMKPCQKVLCQDGHRCPNVCFQ

ECQPCQVKVPKIILKCGHKQMVPCSMSESEFCCQEPCSKILRCGHRCSHLCGEDCVRLCSERVTVELKCGHSQLVKCGNVEDIKYGLPVKCTTKCDTTLD

CGHPCPGSCHSCFEGRFHERCQQPCKRLLICSHKCQEPCTGECPPCQRTCQNRCVHSQCKKKCGELCSPCVEPCVWRCQHYQCTKLCSEPCNRPPCYVPC

TKLLACGHPCIGLCGEPCPKKCRVCQPDEVTQIFFGFEDEPDARFVQLEDCSHIFEVQALDRFMNEQKDDEVAIKLKVCPICQVPIRKNLRYGTSIKQRL

EEIEIVKEKIQGSAGEISTSQEQLKALLKSKTLFHQLRPEEFLILQEKLAQKNLSVKDLGLVENSIRFYDHLANLEGSLEKVHCGEQQSVRTRLEQVHEW

LAKKRLSFSSQELSDLQSEIQRLTYLVNLLMRCKMAEKVKGSIAEEVSSIRNILEKTSKFTQEDEQLVQKKMDALKTTLPCSGLGISDEERVQIVTAMGV

PRGHWFKCPNGHIYVITECGGAMQRSTCPECQEVIGGENHTLERSNHLASEMDGAQHPAWSNTANNFMNFEEIHRMM

For any suggestions or comments, please send an email to unitrap@crg.es