Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000039585 (AC131749.2)
Chromosomal location
Chr 9: 59723177 - 59775005 (+)
Description
not available
UniGene
Mm.407055 Mm.408838 
Human Ortholog
not available
Omim not available
UniTrap UNI27216
Vector Insertion
Chr 9: 59732400 - 59737219
Public Clones not available
Private Clones OST66575 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000085569
Sequence
CCTGTATCCAGCCTGGGTCAGGCCTCTCACAGTGACTCCGAAATG ACATCACAACGATTTTCTTCAGTTGATGAGCAAGCAAAGCTCCATAAGGCTATG

TCTCAAGGAGAGATTACAAAATTGGCAGTAAGACAGAAGGCTTCAGATTTGGACATAAG - UNI27216 - ACCCCAGAGAGCGAAGATGAGATTCTG

GGCCAAAGGGAAACAAGGAGAGAAGAAGACAACTAGAGTAAAACCTGCTTCCCAGTCGGAGATCTCATCATTCTTTCCTGGCCCAGATGTGACACCTGCT

CATCCATTTTCTGACG AGTTAACTCAGTACCACCCAACACCTCCTTTGAGTCCAGAACTGCCTGGGAGTTGTCGAAAAGAGTTCAAAGAGAATAAGGAA

CCTTCTCCAAAGGCAAAGCGCAAGAGAGGTGTAAAAATCAGCAGTGTGGCCTTGGACTCTATGCATTGGCAAAATGACTCTGTCCAAATCATAGCAAGTG

CCAGTGATTTAAAAAGTATGGATGAGTTTCTTCTGAAAAAG ATGAATGACCTAGATAATGAAGACAGCAAGAAGGATACATTAGTGGATGTTGTATTTA

AAAAAGCCCTGAAAGAATTTCGGCAGAATATCTTCAGCTCTTATTCATCTGCATTGGCG ATGGATGATGGGAAAAGCATCCGCTATAAAGACCTATATG

CGCTATTTGAACAGATTCTGGAAAAAACCATGAGATTGGAGCAACGTGATTGGAATGAATCTCCAGTGAGAGTTTGGGTTAACACTTTTAAGGTGTTTTT

AGATGAATACATGAATGAATTCAAGACTTTGGATAGCACAGCCCCAAAG GTGCTTAAAACAGAAAGAAAGAAAAGGAGGAAAAAGGAAACCGATTTG G

TGGAAGAGCACAATGGCCACATCTTTAAGGCCACCCAGTATAGCATCCCTACATACTGTGAATACTGTTCTTCCTTGATATGGATAATGGACAGAGCCTC

TGTTTGCAAAT TGTGTAAGTACGCTTGCCATAAGAAGTGCTGCCTAAAAACCACAGCCAAGTGTTCTAAGAAG TATGATCCAGAGCTGTCATCTCGGC

AATTTGGGGTTGAGCTGTCCCGTTTGACTAGTGAAGACCGAGCTGTTCCTTTAGTGGTAGAGAAGCTCATAAACTATATTGAAATGCATGGACTTTATAC

TGAAGGTATTTACCGAAAGTCTGGTTCAACTAATAAAATCAAGGAGCTTCGACAAGGTCTAGATACAG ATGCTGAAAGTGTAAACCTAGATGACTATAA

CATACATGTCATTGCAAGTGTATTCAAACAATGGCTTCGTGATTTGCCCAATCCACTCATGACTTTTGAACTCTATGAAGAATTCCTTCGAGCTATGG G

CCTTCAGGAAAGAAAAGAGACAATCCGTGGTGTGTACTCTGTAATTGATCAGCTCTCCCGAACTCATCTCAATACACTGGAACGCCTTATCTTTCATCTA

GTTAG GATTGCTCTACAGGAAGACACTAATCGAATGTCTGCTAATGCTTTGGCCATTGTGTTTGCACCTTGCATTCTCCGTTGCCCTGACACTACTGAC

CCACTACAAAGTGTACAAGATATCAGTAAGACTACCAC ATGTGTGGAGCTGATAGTGGTAGAACAAATGAATAAATATAAGGCTCGTCTCAAAGACATC

AGTAGCCTGGAATTTGCTGAAAATAAAGCAAAGACCAGACTGTCACTGATTCGTAGATCAATG GGAAAGGGGCGTATACACCGAGGAAACTATCCAAGT

CCATCTTCCCCTGTTATAGTCCGATTGCCTTCCATGTCTGATGTCCCAGAAGAGACCTTGTCTAGTGAGACAGCCATGGAAACTGACCTCACAGACCAGC

AGCAAGCAGCAATGCAGCAGGAGGAAAAAGTACTGACTGAGCAGATTGAGAACCTACAGAAAGAAAA GGAAGAACTAACATTTGAGATGCTTGTATTGG

AACCTCGTGCCTCTGATGATGAAACCCTTGAATCTGAGGCTTCTATTGGGACTGCTGATAGTTCGGAAAATTTGAATATGGATTCTGAAG AGAGAAGTT

TAGCCCTTAGCTCCCTGAAAGCAGCTGGCAAGTCTGAACCTTCAAGCAAGTCGCGGAAGCAGCTAAGAAAGCAGCCAGACTCTCTAGACTCCGTCAGCTC

CTCCGTTTCTTCATGTCTATCAAACACTACATCATCTCATGGCACTAGAAAGCGATTTCAGATTTATTCCAAGTCTCCATTTTACCGAGCTGCTTCAGCT

TGTGAGGCCCAGGGAACGGAAGGACCGCTAGGCCAAGCCAAATCCCTAGAAGACAGGCCTCAGTTCATCAGCAGAGGAACCTTCAACCCTGAAAAGGGCA

AACAAAAACTAAAGAATGTGAAAAACTCACCTCAGAAAACCAAAGAGACCCCAGAGGGGACAGTCACATCTGGCCGAAAGAAAACTGTGGACTCAGACTG

CAGCTCCACACAGCAACTACCACTGTTTGGAAATAATGAGTTTATGGTCTAAATGGACAGATGTGTCCCCAGATCTCATCTTTGGGGCCTCTTCTGGTCA

CCTTGTTTGTAACAGTCGGTCCTAATGGTCCTGCCTCGTTTCAGCAGACAGATTGTATGCTGGATCACTGGGCTTCTGGCAAAAGTGGCCGCTTTGAAGT

TTGCTAGGGATGGGCCAGCTGTGCCTTGGCTGCTGTATTTGATTTGAGAGTCCACTGAACAAAGCCACCTGGGACCTGGGGGATTTTGGCCAATAATAGT

TGCTTCTTGCCCACCTACTTTTCCCTTCCCACAGATAGTTGCTGAACTAGGGAGCTATTGTGATCCTGAGGTATGCTCTCATTTCTAGCATTTAAAGAAA

ACATACAAACCTCTGTTAACCATGGAAACAAAAGCTTTTGAGTTTGTATTGGAATAGTTAGGAACTGTGTTAGAATATAAAAATTTCCCCAAGGATTTAT

AAGCCCTCTATTTTAAATTTAATTACAAAACATTCAATGTTATCTTTTGGAAACCTAAACTGATTTCCATTAAGCCCAGAGTGTCTCAGCTACAGGAATG

TGAAGAGACCATGCTTTGTCTCTTGTTGATATTTGGTATTATAGTCAGTGCTGGTTTAACGCTTGGTTAATTCCTGCCAAATATATTTCATGGGGTAAAG

TTCTGGTAGCCATACTGTATTGGTATGCCCTGATTATAGATCAGACTCCTCTAGGTTTTTGTTTGAAATATGTCACAGGCACATTTAGGTAATTCCTAAA

TGTGAACGCATCATCCTGATTGATCCAAGCTTTTCTTTTTGTATAAACTGAAGACTGTATCCGAGCCTACTCATCTGCTGGTGGAGTACCACCATAGATG

TAACCATTTCATCACTTATCTAGGAGTACTCACATACATACAACTGTGCATGAGTGTTATAGAAAAAGCCGCCAAAAGAAGTCTAGAAAGTTTAAATATG

ATCTATTTAATTTTTGTCTTCTTATCAGACCATCAGTATTAGATGAAAAAAATCAAGGACTACTTGAAGCTATTTTTGTTAATATTCTTGTTCCTGAAGT

TTACTGTAAATACACATGTATAATATGCCTAGTTCTTTTTAACCTTGTGCTTTCCCCTTATTCCCATTGAGTTTCTCCCTACAGATAAGAGGCCATTAGA

CAGGTGGTGAGAGCCATTCACCCCCGGGGTGAGGAATAAGTAAGGGCATCTTTTTCATCACTGGTAGTTTCCATAAGTTATAATGTCAGAAGCATCATGT

ACTAGCAATTGTGGGACTAGAACTCTGTTTTTGCTATTTATGTTATGTGAAGTGAAACATGATACCATTTCTTAAGTATATGAAATGTTTATTTTTAAAG

TCACTAAATACATTTTGTCTAACTACCACATGCACTGTTACAAGAAGAGCCTTTAATATCCATAACCTGAATTTTGGTTTTCTCCTCCTCCTCTTCTTTT

CCTTCTCCTCCTTCTCCTTTTTTGGTTTGAAGTTACAGGAATAGAAGTCTTTTGTTAAGGCAAGGTCTCTCCTCCTACACAACACTGAACCTCACGCCAC

TGCAATAGTGGTCATTGGCCGGCTCTAGAGATGAGACTTGTAGCATTATTTTGCACAGCAGCTCATGGTGGCTGGAGTCTTCCCTCTCCATGGTATGGGT

TCAGCATTGAGACACATGAAGGAAGTTTTGAAAATCTCCCCGATGATGATGGTCATTCAGTAAATGCTAACTTTTATATCCCTCCAGCATTAACAATAAG

AGTTTTGGAAACTGTTCTACAGGAAGCCAGCATGGCTGTGATATGGTGGGGTGCTGTTTTGGGCCTTTCTGGCTATACAGTCTGTTATAGTATTTGGGGA

AAGTAGCTGCTACTGGGTGGTAACTGTTGCTAACTGTTGCTCTCCACTTGGCTCAGAACAATTTCCTTTGTTTCAGAGGAATGTCCTGGAACTCAGCACT

TGACACACATTCTCCCTCCTAAAGTTTTACAGCTCAGTTTTTTGTTTTTATTATTTCTATAAAGTAAATTTGGGGCTGAGAAAAAAAAAAAACCAACCTA

CCTACATAGGTCACCTTGTAGGAACTAGGTAATCAATATTAAAGACTTTATAATTTTTCTCAGGGACCTAAAACCTGAATTTGAATAAAGTTAAATAAAA

ACTTTTTTTTTCATTTGCT
Translation
  - UNI27216 -  MHWQNDSVQIIASASDLKSMDEFLLKK MNDLDNEDSKKDTLVDVVFKKALKEFRQNIFSSYSSALA MDDGKSIRYKDLYALF

EQILEKTMRLEQRDWNESPVRVWVNTFKVFLDEYMNEFKTLDSTAPK VLKTERKKRRKKETDL VEEHNGHIFKATQYSIPTYCEYCSSLIWIMDRASV

CKL LCKYACHKKCCLKTTAKCSKK YDPELSSRQFGVELSRLTSEDRAVPLVVEKLINYIEMHGLYTEGIYRKSGSTNKIKELRQGLDTD DAESVNLD

DYNIHVIASVFKQWLRDLPNPLMTFELYEEFLRAMG GLQERKETIRGVYSVIDQLSRTHLNTLERLIFHLVR RIALQEDTNRMSANALAIVFAPCILR

CPDTTDPLQSVQDISKTTT TCVELIVVEQMNKYKARLKDISSLEFAENKAKTRLSLIRRSM GKGRIHRGNYPSPSSPVIVRLPSMSDVPEETLSSETA

METDLTDQQQAAMQQEEKVLTEQIENLQKEK KEELTFEMLVLEPRASDDETLESEASIGTADSSENLNMDSEE ERSLALSSLKAAGKSEPSSKSRKQL

RKQPDSLDSVSSSVSSCLSNTTSSHGTRKRFQIYSKSPFYRAASACEAQGTEGPLGQAKSLEDRPQFISRGTFNPEKGKQKLKNVKNSPQKTKETPEGTV

TSGRKKTVDSDCSSTQQLPLFGNNEFMV

For any suggestions or comments, please send an email to unitrap@crg.es