Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000039630 (Hnrnpu)
Chromosomal location
Chr 1: 180258431 - 180267915 (-)
Description
heterogeneous nuclear ribonucleoprotein U Gene [Source:MGI (curated);Acc:Hnrnpu-001]
RefSeq_dna
NM_016805 
RefSeq_peptide
NP_058085.2 
UniGene
Mm.426956 
MGI
MGI:1858195 
Uniprot/SPTREMBL
O88568 Q3TGN5 Q3TS50 Q3TVV6 Q3TWN5 Q3TXW2 Q3ULH5 Q8C290 Q8VEK3 Q9R205 
Human Ortholog
ENSG00000153187 (HNRNPU)
Omim not available
UniTrap UNI6153
Vector Insertion
Chr 1: 180266290 - 180267083
Public Clones YHC129 (baygenomics) CSG051 (baygenomics) D035B10 (ggtc) PST961-3 (escells)
PST1265-2 (escells) IST10852A7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10832
Vector Insertion
Chr 1: 180266087 - 180266177
Public Clones D035B10 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14807
Vector Insertion
Chr 1: 180264017 - 180266087
Public Clones (sanger) D035B10 (ggtc) PST13301-NR (escells) PST10817-NR (escells) PST6518-NR (escells)
PST12130-NR (escells) PST8444-NR (escells) PST2299-NR (escells) PST11264-NR (escells)
PST2804-NL (escells) PST3915-NR (escells) PST12445-NR (escells) PST251-1 (escells)
PST2423-NR (escells) PST9987-NR (escells) PST8209-NR (escells) PST2621-NR (escells)
PST14648-NR (escells) PST10006-NR (escells) PST9012-NR (escells) PST79-1 (escells)
PST12275-NR (escells) PST1593-NR (escells) PST3815-NR (escells) PST10355-NR (escells)
PST8029-NR (escells) PST5281-NR (escells) PSTVU01B3 (vanderbilt)
Private Clones not available
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37501
Vector Insertion
Chr 1: 180261223 - 180261609
Public Clones PST18096-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 70% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15559
Vector Insertion
Chr 1: 180260295 - 180260978
Public Clones PST3688-NR (escells)
Private Clones OST101327 (lexicon)
Severity of mutation (?) Insertion after 87% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22150
Vector Insertion
Chr 1: 180260071 - 180260295
Public Clones not available
Private Clones OST306513 (lexicon)
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000037748
Sequence
GGACGTTGCGTGCTCGCTCGCGCCGGGCGAGTCTCCGCGTCTTGCCTCGCGAACTCGGTGAAAGGAATTGGCGCCGTTCGACACCAGGCGGGTCCGTTCT

GCAGCAGCACTCAGCCATCTCCAGCCGCAGCCGCCGCCCGGGCCGACCAGCAGCAGCCGCCGCCGCCACAGGCCGAGGGAGCCAGCAGTCAGCGGGGAAC

CGGGGCCCTCAACATGAGTTCTTCGCCTGTTAATGTCAAGAAGCTGAAGGTGTCGGAGCTGAAGGAGGAGCTCAAGAAGCGGCGCCTCTCCGACAAGGGC

CTCAAGGCCGATCTCATGGATCGACTCCAGGCCGCGCTGGACAACGAGGCAGGAGGCCGCCCCGCCATGGAGCCCGGGAACGGCAGTCTCGACCTAGGTG

GCGATGCGGCCGGGCGCTCGGGAGCGGGCCTAGAGCAGGAGGCCGCGGCTGGCGCCGAAGACGACGAGGAGGAGGAGGGCATCGCCGCTCTGGACGGCGA

CCAGATGGAGCTGGGCGAGGAGAACGGGGCGGCGGGGGCGGCTGACGCCGGCGCGATGGAGGAAGAGGAGGCAGCGTCGGAAGACGAGAACGGCGACGAC

CAGGGCTTCCAGGAGGGGGAAGACGAGCTCGGCGACGAGGAGGAGGGCGCGGGCGACGAGAACGGTCACGGGGAGCAGCAGTCCCAACCGCCGGCAGCGG

CGGCGCAGCAGCAGCCTTCCCAGCAGCGTGGTGCCGGCAAGGAGGCCGCGGGCAAGAGCAGCGGCCCCACCTCGCTCTTCGCGGTGACGGTGGCGCCGCC

AGGGGCGAGGCAGGGCCAACAGCAGGCGGGAG - UNI6153 - GAGACGGCAAAACAGAACAGAAAGGTGGAGATAAAAAGAGAGGCGTTAAAAGACC

GCGAGAAGATCATGGCCGAGGGTATTTTGAGTACATCGAAGAAAACAAGTACAGCAG - UNI10832 - - UNI14807 - AGCCAAGTCTCCTCAG

CCACCTGTTGAAGAAGAAGACGAACACTTCGATGACACAGTGGTTTGTCTTGATACTT - UNI14807 - ATAATTGTGATCTGCATTTTAAAATCTC

GAGAGACCGTCTGAGTGCTTCTTCCCTTACTATGGAGAGTTTTGCTTTCCTGTGGGCTGGAGGAAGAGCTTCCTACGGTGTGTCAAAAGGCAAAGTCTGC

TTTGAGATGAAG - UNI14807 - GTAACAGAGAAGATTCCAGTAAGACACTTATATACAAAAGATATTGATATACATGAAGTTCGGATTGGCTGGTC

ACTAACCACAAGTGGAATGTTGCTTG GTGAAGAAGAATTTTCTTACGGGTATTCTCTGAAAGGAATAAAAACATGCAACTGTGAGACAGAAGATTATGG

GGAGAAGTTTGATGAAAATGATGTGATTACATGCTTTGCT AACTTTGAAACTGATGAAGTTGAACTCTCTTATGCGAAGAATGGACAAGATCTTGGTGT

TGCCTTTAAGATCAGTAAGGAAGTTCTTGCTGACCGGCCACTATTCCCACATGTTCTCTGCCATAACTGTGCAGTTGAATTTAATTTCGGTCAAAAGGAA

AAGCCATACTTTCCAATACCTGAAGACTGTACTTTTATCCAAAATGTCCCCTTAGAGGACCGAGTTAGAGGACCAAAAGGACCTGAAGAGAAGAAGGATT

GTGAG GTTGTAATGATGATTGGCTTGCCAGGAGCTGGAAAAACTACCTGGGTTACTAAACATGCAGCTGAAAACCCTGGGAAATACAACATTCTTGGAA

CAAATACGATTATGGACAAGATGATG GTGGCAGGTTTTAAGAAGCAAATGGCAGATACTGGAAAACTGAACACACTGTTGCAGAGAGCCCCACAGTGTC

TTGGCAAGTTTATTGAAATTGCTGCCCGTAAGAAGCGAAATTTTATTCTGGATCAG ACAAATGTGTCTGCTGCTGCCCAGAGAAGAAAAATGTGCCTGT

TTGCAGGCTTCCAGCGGAAAGCTGTTGTAGTGTGCCCAAAAGATGAAGACTATAAGCAGAGGACACAGAAGAAGGCAGAAGTAGAGGGGAAGGACCTACC

AGAACATGCTGTCCTCAAGATGAAAG - UNI15559 - GAAACTTCACCCTTCCAGAGGTTGCAGAATGCTTTGATGAAATAACCTATGTTGAACTTC

AGAAAGAGGAAGCCCAAAAGCTTTTGGAGCAATATAAAGAAGAAAGCAAAAAGGCACTGCCACCAGAAAAGAAGCAAAACACTGGCTCAAAGAAAAGCAA

TAAGAATAAGAGTGGCAAGAACCAGTTCAACAGAGGTGGTGGCCATAGAGGCCGTGGAGGATTCAATATGCGAGGTGGCAATTTCAGAGGAGGAG - UN

I15559 - CTCCTGGGAATCGTGGTGGATATAATAGGAGAGGCAACATGCCACAGAGAGGTGGTGGCGGTGGAAGTGGTGGAATTGGCTATCCATACCC

ACGTGGCCCTGTTTTTCCTGGCCGAGGTGGTTACTCAAACAGAGGGAATTACAACAGAGGTGGAATGCCCAACAGAGGGAACTATAACCAG - UNI155

59 - - UNI22150 - AACTTCAGAGGACGAGGAAATAATCGTGGCTACAAAAATCAATCTCAGGGCTACAATCAGTGGCAGCAGGGT CAATTCTGG

GGTCAGAAGCCATGGAGTCAGCATTATCACCAAGGATATTATTGAATACCCAAATAAAACGAACTGATACATATTTCTCCAAAACCTTCACAAGAAGTCG

ACTGTTTTCTTTAGTAGGCTAACTTTTTAAACATTCCACAAGAGGAAGTGCCTGCGGGTTCCTTTTTTAGAAGCTTTGTGGGTTGATTTTTTTTTTTTTC

TTTTCTTTTTTGTACATTTTTAATTGCAGTTTTAAAGTGAATCGTAAGAGAACCTCAGCATTGTGCACGATAAGAGAATGTGTCAGTATTTCAGGGTTCT

ACATTTTATCTGTAAAATGTGACTTTTTTTTTTATCACAACAAAAGTAAAATGTTGCTTTGTACCTGGTGTCTTTTATTAAGCATTTACTCCCCCATTTC

TCACAGAGAATAACAGTCGGGAGTCATTGTCACAATAAAATAGCAATGTTAGCAGCCAGATTCATGGAAGGACTAAGGGGTCCTCATGAATTGCATTAAG

ATTCTGTACTGCTCATGATACACTCCATCCTCTCTAGACTGCCTGCCGGGTAATAGTGGACGGGTAATCTCTGACAAAACGGGAAGGCTATTTTTTTTCT

GTTTGACAATGGAATTGGCATAATTGGGAATGAAGATAAAATTTGGAACCAAGATTGAGAAGATGGAGTGTATGTAGAAGGGCTGTTCAAAAATGTAAAC

TTGGTTGCATTATATGTGGAGGCTCAAACTTGTGAAGGTTAAATACCATAAAATTTTCCATTTGTTCTGCATTTTGATTCTGAAAAGAAAGCTGGCTTTG

CCCATTTCTTATTAAAAAAACTTGTTGTAAATCCAGTTGTCTAATGGGATCTATATGAAGTTAGCTATGTCTGTATGCCCTTCTCCCACAAATACTGTAT

TACTAGTGTGCTTGTAGTAGTTAACTCCACCATCTTTGTAAGCTAATGAAATTGTGAGTCACCCATTTATATCTTAATTTTTAATCATGTCAGTTCTTGA

ATGGGTATCTCCTTAGCCTGCTGATTTCTTTTTCTTTCTAAAGAAAGTGGGTGGAGAAATTAATTTAGACGTTTGTTTGCAATAAAAAGAATTCATTTT
Translation
MSSSPVNVKKLKVSELKEELKKRRLSDKGLKADLMDRLQAALDNEAGGRPAMEPGNGSLDLGGDAAGRSGAGLEQEAAAGAEDDEEEEGIAALDGDQMEL

GEENGAAGAADAGAMEEEEAASEDENGDDQGFQEGEDELGDEEEGAGDENGHGEQQSQPPAAAAQQQPSQQRGAGKEAAGKSSGPTSLFAVTVAPPGARQ

GQQQAGG - UNI6153 - GDGKTEQKGGDKKRGVKRPREDHGRGYFEYIEENKYSR - UNI10832 - - UNI14807 - RAKSPQPPVEEEDEH

FDDTVVCLDTY - UNI14807 - YNCDLHFKISRDRLSASSLTMESFAFLWAGGRASYGVSKGKVCFEMK - UNI14807 - VTEKIPVRHLYTKD

IDIHEVRIGWSLTTSGMLLG GEEEFSYGYSLKGIKTCNCETEDYGEKFDENDVITCFA NFETDEVELSYAKNGQDLGVAFKISKEVLADRPLFPHVLC

HNCAVEFNFGQKEKPYFPIPEDCTFIQNVPLEDRVRGPKGPEEKKDCE VVMMIGLPGAGKTTWVTKHAAENPGKYNILGTNTIMDKMM VAGFKKQMAD

TGKLNTLLQRAPQCLGKFIEIAARKKRNFILDQ TNVSAAAQRRKMCLFAGFQRKAVVVCPKDEDYKQRTQKKAEVEGKDLPEHAVLKMKG - UNI155

59 - GNFTLPEVAECFDEITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQFNRGGGHRGRGGFNMRGGNFRGGA - UNI155

59 - APGNRGGYNRRGNMPQRGGGGGSGGIGYPYPRGPVFPGRGGYSNRGNYNRGGMPNRGNYNQ - UNI15559 - - UNI22150 - NFRGRGN

NRGYKNQSQGYNQWQQG QFWGQKPWSQHYHQGYY

For any suggestions or comments, please send an email to unitrap@crg.es