Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000039671 (Prkcbp1)
Chromosomal location
Chr 2: 165609654 - 165724462 (-)
Description
protein kinase C binding protein 1 Gene [Source:MGI (curated);Acc:Prkcbp1-010]
RefSeq_peptide
NP_081506.3 
UniGene
Mm.227598 Mm.409264 Mm.393102 Mm.474114 
MGI
MGI:1918025 
Uniprot/SPTREMBL
A2A479 A2A482 Q3V437 Q80XT8 A2A483 Q3U1M7 Q3UH28 Q3V1I9 A2A484 Q80Y82 Q8CHB3 A2A485 A2A480 A2A481 Q6P4S7 Q8CIL8 A2A486 
Human Ortholog
ENSG00000101040 (ZMYND8)
Omim not available
UniTrap UNI549
Vector Insertion
Chr 2: 165722451 - 165724415
Public Clones BC0336 (sanger) BC0276 (sanger) BB0063 (sanger) BB0013 (sanger)
BC0308 (sanger) XH908 (baygenomics) XM222 (baygenomics) P024D04 (ggtc)
P010A01 (ggtc) P019C09 (ggtc) 3SE019H03 (ggtc) P112D10 (ggtc) P032F03 (ggtc)
W237D01 (ggtc) P090B05 (ggtc) P006E02 (ggtc) Q012A08 (ggtc) 5SE019H03 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15618
Vector Insertion
Chr 2: 165710107 - 165722451
Public Clones (sanger) 3SE065C03 (ggtc) 3SD030A07 (ggtc) PST5965-NL (escells) PSTVU01.HJ10 (vanderbilt)
IST14127C6 (tigm) IST14670A2 (tigm) IST14643A3 (tigm) IST10419E2 (tigm)
IST14366H6 (tigm) IST15004F8 (tigm) IST14769D2 (tigm) IST10960H10 (tigm)
IST14141C5 (tigm) IST14913D10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30294
Vector Insertion
Chr 2: 165709678 - 165710146
Public Clones D030A04 (ggtc) D034B09 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29769
Vector Insertion
Chr 2: 165708827 - 165709711
Public Clones D111D09 (ggtc) E077D12 (ggtc) D111E09 (ggtc) E079B02 (ggtc) IST14194B3 (tigm)
IST14713D11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29535
Vector Insertion
Chr 2: 165707648 - 165708899
Public Clones (sanger) E064F05 (ggtc) D123A03 (ggtc) E064G02 (ggtc) D144E05 (ggtc)
P097E05 (ggtc) IST11495H12 (tigm) IST14720D2 (tigm) IST14448B11 (tigm)
IST13642G11 (tigm) IST14424F2 (tigm) IST13894C7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29489
Vector Insertion
Chr 2: 165701784 - 165707779
Public Clones (sanger) P137D06 (ggtc) E065E04 (ggtc) D146D05 (ggtc) D065A10 (ggtc)
5SE314H04 (ggtc) P136C01 (ggtc) E021H01 (ggtc) D093E02 (ggtc) P140B11 (ggtc)
P102H09 (ggtc) D151H09 (ggtc) D015F03 (ggtc) 3SE284H07 (ggtc) D038C03 (ggtc)
3SE314H04 (ggtc) P135F10 (ggtc) D168E04 (ggtc) D082E05 (ggtc) P137E12 (ggtc)
5SE284F07 (ggtc) E054D03 (ggtc) D116B01 (ggtc) D157C04 (ggtc) IST14527B3 (tigm)
IST14683G7 (tigm) IST13570B9 (tigm) IST14357G4 (tigm) IST14570C4 (tigm)
IST14099B9 (tigm) IST12357F1 (tigm) IST14564B9 (tigm) IST10466E3 (tigm)
IST10374F4 (tigm) IST12071G11 (tigm) IST14255B3 (tigm) IST13639B9 (tigm)
IST13878B9 (tigm) IST14161C2 (tigm) IST11631B4 (tigm) IST12785B5 (tigm)
IST14623A11 (tigm) IST14538F3 (tigm) IST10933A3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3682
Vector Insertion
Chr 2: 165701276 - 165701784
Public Clones (sanger) XP0236 (sanger) FHCRC-GT-S17-11F1 (fhcrc) FHCRC-GT-S2-1C1 (fhcrc)
FHCRC-GT-S9-4F1 (fhcrc) FHCRC-GT-S21-9H1 (fhcrc) FHCRC-GT-S6-11F1 (fhcrc)
FHCRC-GT-S16-6E1 (fhcrc) FHCRC-GT-S7-2A1 (fhcrc) FHCRC-GT-S17-3D1 (fhcrc)
FHCRC-GT-S6-10D1 (fhcrc) FHCRC-GT-S11-6D1 (fhcrc) FHCRC-GT-S7-10E1 (fhcrc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15763
Vector Insertion
Chr 2: 165701204 - 165701276
Public Clones CMHD-GT_364D12-3 (cmhd) CMHD-GT_379G3-3 (cmhd) CMHD-GT_357D5-3 (cmhd) CMHD-GT_475E4-3 (cmhd)
CMHD-GT_348C8-3 (cmhd) CMHD-GT_522D7-3 (cmhd) CMHD-GT_379G11-3 (cmhd) CMHD-GT_495D3-3 (cmhd)
CMHD-GT_364B7-3 (cmhd) CMHD-GT_429G5-3 (cmhd) CMHD-GT_540B6-3 (cmhd)
Private Clones OST500678 (lexicon) OST470067 (lexicon) OST467862 (lexicon) OST467846 (lexicon)
OST465387 (lexicon) OST463001 (lexicon) OST461761 (lexicon) OST459576 (lexicon)
OST456760 (lexicon) OST455617 (lexicon) OST455095 (lexicon) OST450568 (lexicon)
OST449489 (lexicon) OST444544 (lexicon) OST443820 (lexicon) OST437720 (lexicon)
OST432789 (lexicon) OST430654 (lexicon) OST430618 (lexicon) OST427637 (lexicon)
OST426206 (lexicon) OST425335 (lexicon) OST425098 (lexicon) OST417460 (lexicon)
OST416847 (lexicon) OST415000 (lexicon) OST413681 (lexicon) OST412308 (lexicon)
OST406524 (lexicon) OST395011 (lexicon) OST393637 (lexicon) OST393238 (lexicon)
OST392150 (lexicon) OST390709 (lexicon) OST386399 (lexicon) OST384602 (lexicon)
OST383414 (lexicon) OST382329 (lexicon) OST378921 (lexicon) OST378251 (lexicon)
OST377299 (lexicon) OST375542 (lexicon) OST375371 (lexicon) OST368053 (lexicon)
OST367851 (lexicon) OST367513 (lexicon) OST366066 (lexicon) OST363767 (lexicon)
OST363653 (lexicon) OST358551 (lexicon) OST358383 (lexicon) OST354981 (lexicon)
OST347628 (lexicon) OST345463 (lexicon) OST344764 (lexicon) OST340422 (lexicon)
OST335893 (lexicon) OST335175 (lexicon) OST333793 (lexicon) OST329692 (lexicon)
OST328637 (lexicon) OST323615 (lexicon) OST323611 (lexicon) OST322706 (lexicon)
OST321851 (lexicon) OST319763 (lexicon) OST318532 (lexicon) OST312357 (lexicon)
OST311437 (lexicon) OST311411 (lexicon) OST310387 (lexicon) OST307941 (lexicon)
OST299430 (lexicon) OST292086 (lexicon) OST288210 (lexicon) OST284033 (lexicon)
OST282775 (lexicon) OST279655 (lexicon) OST279492 (lexicon) OST278486 (lexicon)
OST276898 (lexicon) OST275812 (lexicon) OST266782 (lexicon) OST263544 (lexicon)
OST263490 (lexicon) OST262071 (lexicon) OST259742 (lexicon) OST259601 (lexicon)
OST259247 (lexicon) OST257297 (lexicon) OST253321 (lexicon) OST253222 (lexicon)
OST246512 (lexicon) OST246145 (lexicon) OST236089 (lexicon) OST234819 (lexicon)
OST233848 (lexicon) OST233347 (lexicon) OST231594 (lexicon) OST218790 (lexicon)
OST216804 (lexicon) OST205970 (lexicon) OST205565 (lexicon) OST204976 (lexicon)
OST200444 (lexicon) OST200182 (lexicon) OST195173 (lexicon) OST192768 (lexicon)
OST190508 (lexicon) OST190091 (lexicon) OST189518 (lexicon) OST173402 (lexicon)
OST129489 (lexicon) OST124314 (lexicon) OST123677 (lexicon) OST118658 (lexicon)
OST115050 (lexicon) OST111137 (lexicon) OST107401 (lexicon) OST97779 (lexicon)
OST97775 (lexicon) OST97498 (lexicon) OST92643 (lexicon) OST91366 (lexicon)
OST81627 (lexicon) OST80599 (lexicon) OST80006 (lexicon) OST68654 (lexicon)
OST68165 (lexicon) OST67040 (lexicon) OST66993 (lexicon) OST66672 (lexicon)
OST65173 (lexicon) OST64978 (lexicon) OST64934 (lexicon) OST63655 (lexicon)
OST60794 (lexicon) OST60350 (lexicon) OST59935 (lexicon) OST59863 (lexicon)
OST57524 (lexicon) OST57038 (lexicon) OST56277 (lexicon) OST54562 (lexicon)
OST53937 (lexicon) OST53167 (lexicon) OST52893 (lexicon) OST52889 (lexicon)
OST50500 (lexicon) OST47208 (lexicon) OST47149 (lexicon) OST44128 (lexicon)
OST44084 (lexicon) OST43554 (lexicon) OST43015 (lexicon) OST42482 (lexicon)
OST41924 (lexicon) OST41166 (lexicon) OST39891 (lexicon) OST39690 (lexicon)
OST39605 (lexicon) OST39486 (lexicon) OST39397 (lexicon) OST39392 (lexicon)
OST39370 (lexicon) OST37355 (lexicon) OST36342 (lexicon) OST36009 (lexicon)
OST34734 (lexicon) OST34613 (lexicon) OST34377 (lexicon) OST34094 (lexicon)
OST33735 (lexicon) OST31008 (lexicon) OST30467 (lexicon) OST30323 (lexicon)
OST29625 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12801
Vector Insertion
Chr 2: 165701204 - 165701276
Public Clones CMHD-GT_372A2-3 (cmhd) CMHD-GT_374C1-3 (cmhd) CMHD-GT_373C9-3 (cmhd) CMHD-GT_371F1-3 (cmhd)
CMHD-GT_371E9-3 (cmhd) CMHD-GT_309H03-3 (cmhd) CMHD-GT_371E4-3 (cmhd) CMHD-GT_372D7-3 (cmhd)
CMHD-GT_372B6-3 (cmhd) CMHD-GT_371F2-3 (cmhd) CMHD-GT_373C1-3 (cmhd) CMHD-GT_372G3-3 (cmhd)
CMHD-GT_373E11-3 (cmhd) CMHD-GT_372B7-3 (cmhd) CMHD-GT_261B4-3 (cmhd) CMHD-GT_372F8-3 (cmhd)
CMHD-GT_371B12-3 (cmhd) CMHD-GT_372A6-3 (cmhd) CMHD-GT_371H12-3 (cmhd) CMHD-GT_372B12-3 (cmhd)
CMHD-GT_343H3-3 (cmhd) CMHD-GT_372E8-3 (cmhd) CMHD-GT_374G4-3 (cmhd) CMHD-GT_371F10-3 (cmhd)
CMHD-GT_82D3-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5223
Vector Insertion
Chr 2: 165678384 - 165701204
Public Clones CSI346 (baygenomics) RHA209 (baygenomics) YTA002 (baygenomics) RRD264 (baygenomics)
YHD026 (baygenomics) HMA242 (baygenomics) YTA346 (baygenomics) XE411 (baygenomics)
BGD049 (baygenomics) YTC062 (baygenomics) RRD262 (baygenomics) P020F09 (ggtc)
W269A04 (ggtc) A020B04 (ggtc) P065A01 (ggtc) W088C03 (ggtc) W014D06 (ggtc)
P016E03 (ggtc) A020A05 (ggtc) D002G04 (ggtc) A054D02 (ggtc) W015H02 (ggtc)
P027E07 (ggtc) A013E06 (ggtc) P017A11 (ggtc) A020E07 (ggtc) P090E08 (ggtc)
A052D05 (ggtc) W023F07 (ggtc) W024A03 (ggtc) W079F06 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15045
Vector Insertion
Chr 2: 165678367 - 165701276
Public Clones (sanger) P147C06 (ggtc) E077G06 (ggtc) P126E03 (ggtc) D164G07 (ggtc)
3SE287E01 (ggtc) E090F03 (ggtc) D170H09 (ggtc) E122E04 (ggtc) D002G04 (ggtc)
5SE314E02 (ggtc) P127C07 (ggtc) 3SE314E02 (ggtc) PST5531-NR (escells)
PST18146-NR (escells) PST10414-NR (escells) PST14164-NR (escells) IST14462A5 (tigm)
IST11300H6 (tigm) IST10458B4 (tigm) IST13697A11 (tigm) IST12251E3 (tigm)
IST11174E10 (tigm) IST12152B10 (tigm) IST12684E9 (tigm) IST14180B8 (tigm)
IST10044B3 (tigm) IST14649D7 (tigm) IST12270H1 (tigm) IST10882G1 (tigm)
IST12491C5 (tigm) IST14194G7 (tigm) IST15056G5 (tigm) IST14291E2 (tigm)
IST12647E3 (tigm) IST14947F1 (tigm) IST10055F11 (tigm) IST11080B8 (tigm)
IST12877A8 (tigm) IST14562B4 (tigm) IST11392B3 (tigm) IST12152C4 (tigm)
IST11350A10HMF1 (tigm) IST14799G6 (tigm) IST12724E9 (tigm) IST13321H8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14301
Vector Insertion
Chr 2: 165677499 - 165678380
Public Clones FHCRC-GT-S1-12F1 (fhcrc) FHCRC-GT-S16-11C1 (fhcrc) FHCRC-GT-S1-3C1 (fhcrc)
FHCRC-GT-S10-7G1 (fhcrc) FHCRC-GT-S20-4F1 (fhcrc)
Private Clones not available
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12811
Vector Insertion
Chr 2: 165677499 - 165677649
Public Clones CMHD-GT_372C9-3 (cmhd) CMHD-GT_508H6-3 (cmhd) CMHD-GT_372B8-3 (cmhd) CMHD-GT_372C5-3 (cmhd)
CMHD-GT_267C8-3 (cmhd) CMHD-GT_372D4-3 (cmhd) CMHD-GT_505D3-3 (cmhd) CMHD-GT_276F7-3 (cmhd)
CMHD-GT_371C4-3 (cmhd) CMHD-GT_516H5-3 (cmhd) CMHD-GT_374A5-3 (cmhd) CMHD-GT_499B7-3 (cmhd)
CMHD-GT_371B4-3 (cmhd) CMHD-GT_276E12-3 (cmhd)
Private Clones OST468138 (lexicon) OST461653 (lexicon) OST460534 (lexicon) OST460162 (lexicon)
OST458442 (lexicon) OST447406 (lexicon) OST439224 (lexicon) OST429188 (lexicon)
OST425157 (lexicon) OST416888 (lexicon) OST407862 (lexicon) OST406146 (lexicon)
OST403392 (lexicon) OST401854 (lexicon) OST395090 (lexicon) OST392894 (lexicon)
OST392532 (lexicon) OST382137 (lexicon) OST376502 (lexicon) OST371745 (lexicon)
OST366234 (lexicon) OST365233 (lexicon) OST361878 (lexicon) OST359808 (lexicon)
OST359257 (lexicon) OST356536 (lexicon) OST355236 (lexicon) OST354618 (lexicon)
OST348355 (lexicon) OST345457 (lexicon) OST342552 (lexicon) OST341496 (lexicon)
OST319909 (lexicon) OST288960 (lexicon) OST283753 (lexicon) OST275400 (lexicon)
OST274924 (lexicon) OST270060 (lexicon) OST269617 (lexicon) OST258347 (lexicon)
OST232407 (lexicon) OST225989 (lexicon) OST212450 (lexicon) OST204057 (lexicon)
OST201646 (lexicon) OST195780 (lexicon) OST194181 (lexicon) OST192223 (lexicon)
OST189517 (lexicon) OST173703 (lexicon) OST172821 (lexicon) OST131482 (lexicon)
OST123690 (lexicon) OST122806 (lexicon) OST117036 (lexicon) OST115708 (lexicon)
OST115347 (lexicon) OST78475 (lexicon) OST68484 (lexicon) OST67205 (lexicon)
OST64787 (lexicon) OST64230 (lexicon) OST63921 (lexicon) OST63867 (lexicon)
OST63866 (lexicon) OST61222 (lexicon) OST60935 (lexicon) OST60680 (lexicon)
OST59992 (lexicon) OST58853 (lexicon) OST55596 (lexicon) OST55331 (lexicon)
OST54903 (lexicon) OST54516 (lexicon) OST54364 (lexicon) OST53872 (lexicon)
OST47483 (lexicon) OST46180 (lexicon) OST43582 (lexicon) OST41860 (lexicon)
OST41619 (lexicon) OST40512 (lexicon) OST40374 (lexicon) OST39892 (lexicon)
OST37443 (lexicon) OST34458 (lexicon) OST33782 (lexicon) OST33283 (lexicon)
OST31061 (lexicon) OST30207 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7754
Vector Insertion
Chr 2: 165671740 - 165677532
Public Clones RRN136 (baygenomics)
Private Clones OST81243 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25158
Vector Insertion
Chr 2: 165671520 - 165671665
Public Clones not available
Private Clones OST193563 (lexicon) OST38906 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24744
Vector Insertion
Chr 2: 165665591 - 165668263
Public Clones not available
Private Clones OST208306 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3669
Vector Insertion
Chr 2: 165658925 - 165660389
Public Clones AQ0464 (sanger) XA028 (baygenomics) IST14733A5 (tigm) IST15092C5 (tigm)
Private Clones OST386015 (lexicon)
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12805
Vector Insertion
Chr 2: 165654190 - 165658808
Public Clones CMHD-GT_340C11-3 (cmhd) CMHD-GT_160E8-3 (cmhd) CMHD-GT_369F4-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29610
Vector Insertion
Chr 2: 165653707 - 165658925
Public Clones E139B07 (ggtc) IST10138E1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5045
Vector Insertion
Chr 2: 165652681 - 165654190
Public Clones SYA210 (baygenomics) XH675 (baygenomics) CSI179 (baygenomics) RRA008 (baygenomics)
YTC010 (baygenomics) RHA008 (baygenomics) CSI057 (baygenomics) XE342 (baygenomics)
CSI444 (baygenomics) SYA318 (baygenomics) XH683 (baygenomics) CSI066 (baygenomics)
XC267 (baygenomics) YTC504 (baygenomics) CSH416 (baygenomics) A053C07 (ggtc)
CMHD-GT_410E9-3 (cmhd)
Private Clones OST455721 (lexicon) OST276317 (lexicon)
Severity of mutation (?) Insertion after 37% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6317
Vector Insertion
Chr 2: 165646041 - 165646189
Public Clones YHB220 (baygenomics) CSD365 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 37% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33792
Vector Insertion
Chr 2: 165646041 - 165654190
Public Clones (sanger) IST10680D8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 37% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI144
Vector Insertion
Chr 2: 165640816 - 165640970
Public Clones GC0107 (tigem) CSH409 (baygenomics) YTC814 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36697
Vector Insertion
Chr 2: 165640816 - 165646189
Public Clones (sanger) IST12508H8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31684
Vector Insertion
Chr 2: 165637848 - 165640970
Public Clones (sanger) IST13647F12 (tigm) IST12389G6 (tigm) IST14778G3 (tigm) IST13818E8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 45% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI113
Vector Insertion
Chr 2: 165637848 - 165638359
Public Clones GC0209 (tigem) GC0042 (tigem) XE363 (baygenomics) YTA279 (baygenomics)
A056C04 (ggtc) W084A02 (ggtc) P135B10 (ggtc) W089E06 (ggtc) W046D08 (ggtc)
A056B04 (ggtc) W089A05 (ggtc) CMHD-GT_35D2-5 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 45% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14944
Vector Insertion
Chr 2: 165633174 - 165638359
Public Clones PST11965-NR (escells) PST1050-3 (escells)
Private Clones not available
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI238
Vector Insertion
Chr 2: 165633018 - 165633430
Public Clones GC0693 (tigem)
Private Clones not available
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15535
Vector Insertion
Chr 2: 165633018 - 165638359
Public Clones (sanger) P135B10 (ggtc) PST9542-NR (escells) IST10429B11 (tigm) IST10875A1 (tigm)
IST13677C4 (tigm) IST10980H12 (tigm) IST14425D1 (tigm) IST15105E8 (tigm)
IST12139G11 (tigm) IST14938D11 (tigm) IST10487F2 (tigm) IST10037A2 (tigm)
IST14968E6 (tigm) IST10909F10 (tigm) IST10062A8 (tigm) IST10507G7 (tigm)
IST10521B12 (tigm) IST11432G5 (tigm) IST11636H3 (tigm) IST10258E8 (tigm)
IST14914H6 (tigm) IST10607E5 (tigm) IST10013A7 (tigm) IST10056F2 (tigm)
IST10464A7 (tigm) IST10947B3 (tigm) IST11485F11 (tigm) IST14725D6 (tigm)
IST14855D2 (tigm) IST10671H10 (tigm) IST10427E12 (tigm) IST10062A7 (tigm)
IST10679B1 (tigm) IST14403B10 (tigm) IST13263A12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21114
Vector Insertion
Chr 2: 165633018 - 165633430
Public Clones not available
Private Clones OST340761 (lexicon)
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7428
Vector Insertion
Chr 2: 165630686 - 165630878
Public Clones RRS708 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 71% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15537
Vector Insertion
Chr 2: 165630686 - 165633430
Public Clones PST9006-NR (escells) IST10038D10 (tigm) IST12919E1 (tigm) IST12554E1 (tigm)
IST13055G8 (tigm)
Private Clones OST274466 (lexicon) OST170949 (lexicon) OST74044 (lexicon)
Severity of mutation (?) Insertion after 71% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32699
Vector Insertion
Chr 2: 165623433 - 165630878
Public Clones (sanger) IST14980G3 (tigm) IST11721G10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 76% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28133
Vector Insertion
Chr 2: 165621662 - 165623433
Public Clones IST10335H6 (tigm)
Private Clones OST39052 (lexicon)
Severity of mutation (?) Insertion after 78% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28132
Vector Insertion
Chr 2: 165620135 - 165621582
Public Clones not available
Private Clones OST39057 (lexicon)
Severity of mutation (?) Insertion after 81% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18789
Vector Insertion
Chr 2: 165618468 - 165619894
Public Clones not available
Private Clones OST414323 (lexicon)
Severity of mutation (?) Insertion after 87% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12375
Vector Insertion
Chr 2: 165618311 - 165618468
Public Clones W047A02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 87% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21885
Vector Insertion
Chr 2: 165618303 - 165618468
Public Clones not available
Private Clones OST314768 (lexicon)
Severity of mutation (?) Insertion after 87% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI729
Vector Insertion
Chr 2: 165612748 - 165617404
Public Clones DB0019 (sanger) CSE025 (baygenomics) CSE033 (baygenomics) A020A06 (ggtc)
A020F03 (ggtc)
Private Clones OST374655 (lexicon)
Severity of mutation (?) Insertion after 94% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109266
Sequence
AGTATTGACATTACACAGTTAACAATGCATCCACAGAG - UNI3682 - - UNI12801 - - UNI15045 - - UNI15618 - - UNI15763

 - - UNI29489 - - UNI29535 - - UNI29769 - - UNI30294 - CTTGGCTGAAGAGGAAATAAAAACCGAGCAGGAGGTGGTGGAGGG

AATGGATATCTCTACTCGCTCCAAAG - UNI5223 - - UNI12801 - - UNI12811 - - UNI14301 - - UNI15045 - - UNI1576

3 - ATCCTGTCTCTACAGAGAAAACGGCCCCGAAACGGAGGTTCCCCAGCCCTCCACATTCCTCCAATGGCCATTCGCCCCAAGACTCATCCACGAGCC

CCATTAAAAAGAAAAAGAAACCCGGCTTACTCAACAGTAGCAATAAGGAACAG - UNI7754 - - UNI12811 - - UNI14301 - - UNI251

58 - GACGGACGGAATGACTTCTATTGCTGGGTTTGTCACCGGGAAGGACAAGTCCTTTGCTGTGAGCTCTGTCCCCGGGTTTATCACGCTAAGTGTCT

GAGACTGACATCGGAGCCAGAGGGGGACTGGTTTTGTCCTGAATGTGAG - UNI25158 - AAGATTACAGTAGCAGAATGCATCGAGACGCAGAGCA

AAGCCATGACCATGCTGACCATTGAACAACTGTCCTACCTGCTCAAGTTTGCCATTCAGAAAATGAAGCAGCCAGGG - UNI24744 - ACGGATGCA

TTCCAGAAGCCTGTTCCATTGGAGCAACACCCTGACTATGCAGAATATATTTTCCACCCCATGGACCTTTGTACATTGGAAAAG AATGCAAAAAAGAAG

ATGTACGGCTGCACAGAAGCCTTCCTGGCCGATGCCAAGTGGATCCTGCACAACTGCATTATTTATAATGGGG GAAATCACAAGTTGACGCAAATAGCA

AAAGTCGTCATCAAAATCTGTGAGCACGAG ATGAATGAAATCGAAGTCTGTCCAGAATGTTATCTTGCAGCTTGCCAAAAACGAGACAACTGGTTCTGT

GAGCCCTGT - UNI3669 - - UNI29610 - AGCAATCCGCACCCTTTGGTCTGGGCAAAACTGAAAGGATTTCCATTCTGGCCAGCGAAAGCTCT

GAGGGACAAAGACGGGCAGGTTGACGCCCGTTTCTTTGGACAACATGACAG - UNI5045 - - UNI12805 - - UNI29610 - - UNI33792

 - AGCCTGGGTTCCAGTCAATAATTGCTACCTCATGTCTAAAGAAATCCCCTTTTCTGTGAAAAAGACTAAAAGTATCTTCAACAGCGCCATGCAAGAG

ATGGAAGTTTACGTGGAGAACATACGGAGGAAGTTTGGGGTTTTTAATTACTCCCCGTTCAGGACGCCCTACACGCCCAACAACCAGTACCAAATGCTGC

TGGATCCCAGCAACCCCAGCGCGGGCACAGCCAAGACAGACAAACAGGAGAAGGTGAAGCTTAATTTTGACATGACAGCGTCCCCCAAGATCCTTCTGAG

CAAGCCCCTTCTGAGCGGGGGTGCCGGCCGCAGGATCTCCCTGTCCGACATGCCTCGCTCCCCCACCAGTACGAACTCTTCCGTGCACACGGGCTCCGAT

GTGGAGCAGGACCCCGAGAAGAAGGCCCCGTCCAGCCACTTCAGCGCAAGCGAGGAGTCCATGGACTTCCTTGATAAGAGCACAG - UNI5045 - - 

UNI6317 - - UNI29610 - - UNI33792 - - UNI36697 - CTTCTCCAGCCTCCACCAAGACGGGGCAAGCCGGGAGCTTGTCTGGCAGCC

CAAAGCCTTTCTCTCCGCAAGCGCCGACACCCATCATGACAAAACCCGACAAGACTTCCACCTCCACCACCGGGAGCATCCTGAACCTGAACTTGG - U

NI144 - - UNI6317 - - UNI31684 - - UNI33792 - - UNI36697 - ATCGAAGCAAGGCCGAGATGGACCTGAAGGAGCTGAGCGAG

TCGGTCCAGCAGCAGTCAGCCCCCGTCCCTCTCATCTCTCCCAAGCGGCAGATTCGAAGCCGGTTCCAGCTCAACCTGGACAAGACCATAGAGAGTTGCA

AAGCACAGCTAG - UNI113 - - UNI144 - - UNI14944 - - UNI15535 - - UNI31684 - - UNI36697 - GCATAAATGAGAT

CTCAGAGGATGTTTATACAGCCGTGGAGCACAGCGATTCCGAGGACTCCGAAAAGTCGGAGAGCAGCGACAGCGAGTACGTCAGCGATGAGGAACAGAAG

CCCAAGAATGAGCCCGAGGACCCCGAGGACAAAGAGGGGAGTCGGGTGGACAAAGAGGCCCCTGCCATCAAAAGGAAGCCCAAACCCACAAACCAGGTAG

AGGTCAAAGAGGAAGCGAAGAGCAACTCTCCTGTCAGCGAGAAGCCGGACCCCACACCCGCCAAGGACAAGGCCAGCCCAGAGCCTGAGAAGGACTTTGT

AGAGAAAGCAAAGCCATCACCTCATCCCACAAAGGACAAACTGAAAGGAAAGGATGAAACGGATTCTCCCACAGTGCACTTGGGCTTGGATTCGGACTCG

GAGAGCGAACTTGTCATAGACTTAGGAGAGGATCCTTCTGGGAGGGAGGGTCGAAAAAACAAGAAAGATCCCAAGGTGCCGTCGCCTAAGCAAGACG - 

UNI113 - - UNI238 - - UNI14944 - - UNI15535 - - UNI15537 - - UNI21114 - - UNI31684 - CTATAGGTAAACCGC

CACCGTCGTCCACTTCGGCGGGCAACCAGTCTCCCCCAGAGACACCGGTACTCACCCGCTCAGCCACCCAAGCACCCGCGGCTGGGGTCACCGTGGCCGC

CGCCACCACCAGCACGATGTCTACCGTCACAGTCACGGCACCGGCCACCGCCGTCACGGGAAGCCCGGTGAAGAAGCAGAGGCCGCTCTTACCGAAGGAG

ACTGTCCCAGCTGTGCAGCGGGTCGTGTGGAACGCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATACAGCGCCAGCAGCAGC

AGCAGCAACAACAACAGCAGAGCCAACAGCAGAGCCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAG - U

NI238 - - UNI7428 - - UNI15535 - - UNI15537 - - UNI21114 - - UNI32699 - CTGTCCAGCAGAAGGAGGTCACCCAGAG

CCCATCCACGTCCACCATCACGCTGGTGACCAGCACACAGCCGGCAGCCCTGGTCAGCAGTTCGGGCTCAGCAAGCACCCTGGCGTCTGCAATCAATGCC

GACCTTCCCATTGCCACCGCCTCGGCCGACGTGGCCGCAGACATTGCCAAGTACACCAGCAAA - UNI7428 - - UNI15537 - - UNI32699 

- ATGATGGATGCCATAAAGGGGACGATGACAGAAATCTACAATGACCTCTCCAAGAACACCACTGGGAGCACAATAGCTGAG - UNI28133 - - U

NI32699 - ATTCGAAGGCTGAGGATTGAGATTGAGAAACTGCAGTGGCTGCACCAGCAGGAGCTCGCTGAGATGAAGCACAACCTGG - UNI28132

 - AGTTGACCATGGCCGAGATGCGGCAGAGCCTGGAACAGGAGCGGGATCGGCTCATTGCCGAGGTGAAAAAGCAACTGGAGCTGGAGAAGCAGCAGGC

GGTGGACGAGACCAAGAAGAAGCAGTGGTGTGCCAACTGCAAGAAGGAGGCCATTTTCTACTGCTGCTGGAACACCAGCTACTGTGACTACCCCTGTCAG

CAGGCCCACTGGCCCGAGCACATGAAGTCCTGTACCCAGTCGG - UNI12375 - - UNI18789 - - UNI21885 - CGACTGCCCCTCAGCAG

GAAGCAGATGCCGAGGCAAGCACAGAAACAGGAAATAAGTCATCGCAGGGCAACTCCTCCAACACACAGTCAGCACCTTCAGAACCGGCCAGCGCCCCCA

AAGAGAAAGAGGCGCCAGCGGAGAAGAGCAAGGACAGTAGTAACTCG - UNI21885 - ACCCTGGATCTTTCCGGCTCCAGAGAGACGCCCTCCTCT

ATGCTCTTAGGCTCCAATCAAAGCTCTG - UNI729 - TTAGCAAGAGGTGTGACAAGCAGCCTGCCTATACCCCAACCACTACAGACCACCAGCCGC

ACCCCAACTACCCAGCCCAGAAGT ACCATTCCCGGAGCAGCAAGGCAGGTTTGTGGAGCAGCAGCGAGGAGAAGCGAGCGTCATCCCGCTCTGAGCACA

GTGGAGGGACCAGCACGAAGAACCTCATGCCCAAAGAGTCCCGGGAGTCTCGGCTAGATGCCTTCTGGGACTAGGGGTGCATTGTGAGCCAGAACACCTC

CCTATAGGCGGGAGAAACAGCCCAAACCACAGGAAGCAACAGAAACTGGAGAACCGCCACCTTTAGAATTTCCAACACTCAGGCTCTGCCCGTCGGCTTG

GCTGCAGGACAGAGACTTGACTCCATCCCAGCTCTGGTCTTGGCTGGGATGGCACTACCCTGTGAGCCAAACACTTTAGGTGTAAGTAGGTACACTTGTG

ACGTCACTGACCTAGCGTACCTTTCCTTTTCATATCTACACTGACCTTAACTT
Translation
 - UNI3682 - - UNI12801 - - UNI15045 - - UNI15618 - - UNI15763 - - UNI29489 - - UNI29535 - - UNI2976

9 - - UNI30294 - MDISTRSKD - UNI5223 - - UNI12801 - - UNI12811 - - UNI14301 - - UNI15045 - - UNI1576

3 - DPVSTEKTAPKRRFPSPPHSSNGHSPQDSSTSPIKKKKKPGLLNSSNKEQ - UNI7754 - - UNI12811 - - UNI14301 - - UNI25

158 - DGRNDFYCWVCHREGQVLCCELCPRVYHAKCLRLTSEPEGDWFCPECE - UNI25158 - KITVAECIETQSKAMTMLTIEQLSYLLKFAIQ

KMKQPG - UNI24744 - TDAFQKPVPLEQHPDYAEYIFHPMDLCTLEK NAKKKMYGCTEAFLADAKWILHNCIIYNGG GNHKLTQIAKVVIKICE

HE MNEIEVCPECYLAACQKRDNWFCEPC - UNI3669 - - UNI29610 - SNPHPLVWAKLKGFPFWPAKALRDKDGQVDARFFGQHDR - UNI

5045 - - UNI12805 - - UNI29610 - - UNI33792 - RAWVPVNNCYLMSKEIPFSVKKTKSIFNSAMQEMEVYVENIRRKFGVFNYSPFR

TPYTPNNQYQMLLDPSNPSAGTAKTDKQEKVKLNFDMTASPKILLSKPLLSGGAGRRISLSDMPRSPTSTNSSVHTGSDVEQDPEKKAPSSHFSASEESM

DFLDKSTA - UNI5045 - - UNI6317 - - UNI29610 - - UNI33792 - - UNI36697 - ASPASTKTGQAGSLSGSPKPFSPQAPTP

IMTKPDKTSTSTTGSILNLNLD - UNI144 - - UNI6317 - - UNI31684 - - UNI33792 - - UNI36697 - DRSKAEMDLKELSES

VQQQSAPVPLISPKRQIRSRFQLNLDKTIESCKAQLG - UNI113 - - UNI144 - - UNI14944 - - UNI15535 - - UNI31684 - -

 UNI36697 - GINEISEDVYTAVEHSDSEDSEKSESSDSEYVSDEEQKPKNEPEDPEDKEGSRVDKEAPAIKRKPKPTNQVEVKEEAKSNSPVSEKPD

PTPAKDKASPEPEKDFVEKAKPSPHPTKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDPSGREGRKNKKDPKVPSPKQDA - UNI113 - - UNI

238 - - UNI14944 - - UNI15535 - - UNI15537 - - UNI21114 - - UNI31684 - AIGKPPPSSTSAGNQSPPETPVLTRSATQ

APAAGVTVAAATTSTMSTVTVTAPATAVTGSPVKKQRPLLPKETVPAVQRVVWNASSKFQTSSQKWHMQKIQRQQQQQQQQQQSQQQSQQQQPQSSQGTR

YQTRQAVKA - UNI238 - - UNI7428 - - UNI15535 - - UNI15537 - - UNI21114 - - UNI32699 - AVQQKEVTQSPSTST

ITLVTSTQPAALVSSSGSASTLASAINADLPIATASADVAADIAKYTSK - UNI7428 - - UNI15537 - - UNI32699 - MMDAIKGTMTEI

YNDLSKNTTGSTIAE - UNI28133 - - UNI32699 - IRRLRIEIEKLQWLHQQELAEMKHNLE - UNI28132 - ELTMAEMRQSLEQERDR

LIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSA - UNI12375 - - UNI18789 - - UNI2188

5 - ATAPQQEADAEASTETGNKSSQGNSSNTQSAPSEPASAPKEKEAPAEKSKDSSNS - UNI21885 - TLDLSGSRETPSSMLLGSNQSSV - U

NI729 - VSKRCDKQPAYTPTTTDHQPHPNYPAQKY YHSRSSKAGLWSSSEEKRASSRSEHSGGTSTKNLMPKESRESRLDAFWD
Transcript ENSMUST00000099084
Sequence
AAGAGCACGCATTAAAATGGCTCCTACAGGTTTGGGAAGCCAGGATCTGTTTGTGAGTGTGAACCTCAGCCAATTTCCCAGCCCTGACTCAAGCTGGCTG

CTTTTCCTCGTGGCCACCACAGTGCCTGGG - UNI3682 - - UNI12801 - - UNI15045 - - UNI15763 - - UNI29489 - - UNI

29535 - CTTGGCTGAAGAGGAAATAAAAACCGAGCAGGAGGTGGTGGAGGGAATGGATATCTCTACTCGCTCCAAAG - UNI5223 - - UNI128

01 - - UNI12811 - - UNI14301 - - UNI15045 - - UNI15763 - ATCCTGTCTCTACAGAGAAAACGGCCCCGAAACGGAGGTTCCC

CAGCCCTCCACATTCCTCCAATGGCCATTCGCCCCAAGACTCATCCACGAGCCCCATTAAAAAGAAAAAGAAACCCGGCTTACTCAACAGTAGCAATAAG

GAACAG - UNI7754 - - UNI12811 - - UNI14301 - - UNI25158 - GACGGACGGAATGACTTCTATTGCTGGGTTTGTCACCGGGAA

GGACAAGTCCTTTGCTGTGAGCTCTGTCCCCGGGTTTATCACGCTAAGTGTCTGAGACTGACATCGGAGCCAGAGGGGGACTGGTTTTGTCCTGAATGTG

AG - UNI25158 - AAGATTACAGTAGCAGAATGCATCGAGACGCAGAGCAAAGCCATGACCATGCTGACCATTGAACAACTGTCCTACCTGCTCAAG

TTTGCCATTCAGAAAATGAAGCAGCCAGGG - UNI24744 - ACGGATGCATTCCAGAAGCCTGTTCCATTGGAGCAACACCCTGACTATGCAGAATA

TATTTTCCACCCCATGGACCTTTGTACATTGGAAAAG AATGCAAAAAAGAAGATGTACGGCTGCACAGAAGCCTTCCTGGCCGATGCCAAGTGGATCCT

GCACAACTGCATTATTTATAATGGGG GAAATCACAAGTTGACGCAAATAGCAAAAGTCGTCATCAAAATCTGTGAGCACGAG ATGAATGAAATCGAAG

TCTGTCCAGAATGTTATCTTGCAGCTTGCCAAAAACGAGACAACTGGTTCTGTGAGCCCTGT - UNI3669 - - UNI29610 - AGCAATCCGCAC

CCTTTGGTCTGGGCAAAACTGAAAGGATTTCCATTCTGGCCAGCGAAAGCTCTGAGGGACAAAGACGGGCAGGTTGACGCCCGTTTCTTTGGACAACATG

ACAG - UNI5045 - - UNI12805 - - UNI29610 - - UNI33792 - AGCCTGGGTTCCAGTCAATAATTGCTACCTCATGTCTAAAGAAA

TCCCCTTTTCTGTGAAAAAGACTAAAAGTATCTTCAACAGCGCCATGCAAGAGATGGAAGTTTACGTGGAGAACATACGGAGGAAGTTTGGGGTTTTTAA

TTACTCCCCGTTCAGGACGCCCTACACGCCCAACAACCAGTACCAAATGCTGCTGGATCCCAGCAACCCCAGCGCGGGCACAGCCAAGACAGACAAACAG

GAGAAGGTGAAGCTTAATTTTGACATGACAGCGTCCCCCAAGATCCTTCTGAGCAAGCCCCTTCTGAGCGGGGGTGCCGGCCGCAGGATCTCCCTGTCCG

ACATGCCTCGCTCCCCCACCAGTACGAACTCTTCCGTGCACACGGGCTCCGATGTGGAGCAGGACCCCGAGAAGAAGGCCCCGTCCAGCCACTTCAGCGC

AAGCGAGGAGTCCATGGACTTCCTTGATAAGAGCACAG - UNI5045 - - UNI6317 - - UNI29610 - - UNI33792 - - UNI36697 

- CTTCTCCAGCCTCCACCAAGACGGGGCAAGCCGGGAGCTTGTCTGGCAGCCCAAAGCCTTTCTCTCCGCAAGCGCCGACACCCATCATGACAAAACCC

GACAAGACTTCCACCTCCACCACCGGGAGCATCCTGAACCTGAACTTGG - UNI144 - - UNI6317 - - UNI31684 - - UNI33792 - -

 UNI36697 - ATCGAAGCAAGGCCGAGATGGACCTGAAGGAGCTGAGCGAGTCGGTCCAGCAGCAGTCAGCCCCCGTCCCTCTCATCTCTCCCAAGCG

GCAGATTCGAAGCCGGTTCCAGCTCAACCTGGACAAGACCATAGAGAGTTGCAAAGCACAGCTAG - UNI113 - - UNI144 - - UNI14944 -

 - UNI15535 - - UNI31684 - - UNI36697 - GCATAAATGAGATCTCAGAGGATGTTTATACAGCCGTGGAGCACAGCGATTCCGAGGACT

CCGAAAAGTCGGAGAGCAGCGACAGCGAGTACGTCAGCGATGAGGAACAGAAGCCCAAGAATGAGCCCGAGGACCCCGAGGACAAAGAGGGGAGTCGGGT

GGACAAAGAGGCCCCTGCCATCAAAAGGAAGCCCAAACCCACAAACCAGGTAGAGGTCAAAGAGGAAGCGAAGAGCAACTCTCCTGTCAGCGAGAAGCCG

GACCCCACACCCGCCAAGGACAAGGCCAGCCCAGAGCCTGAGAAGGACTTTGTAGAGAAAGCAAAGCCATCACCTCATCCCACAAAGGACAAACTGAAAG

GAAAGGATGAAACGGATTCTCCCACAGTGCACTTGGGCTTGGATTCGGACTCGGAGAGCGAACTTGTCATAGACTTAGGAGAGGATCCTTCTGGGAGGGA

GGGTCGAAAAAACAAGAAAGATCCCAAGGTGCCGTCGCCTAAGCAAGACG - UNI113 - - UNI238 - - UNI14944 - - UNI15535 - -

 UNI15537 - - UNI21114 - - UNI31684 - CTATAGGTAAACCGCCACCGTCGTCCACTTCGGCGGGCAACCAGTCTCCCCCAGAGACACCG

GTACTCACCCGCTCAGCCACCCAAGCACCCGCGGCTGGGGTCACCGTGGCCGCCGCCACCACCAGCACGATGTCTACCGTCACAGTCACGGCACCGGCCA

CCGCCGTCACGGGAAGCCCGGTGAAGAAGCAGAGGCCGCTCTTACCGAAGGAGACTGTCCCAGCTGTGCAGCGGGTCGTGTGGAACGCATCAAGTAAGTT

TCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATACAGCGCCAGCAGCAGCAGCAGCAACAACAACAGCAGAGCCAACAGCAGAGCCAGCAGCAGCAG

CCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAG - UNI238 - - UNI7428 - - UNI15535 - - UNI15537 - -

 UNI21114 - - UNI32699 - CTGTCCAGCAGAAGGAGGTCACCCAGAGCCCATCCACGTCCACCATCACGCTGGTGACCAGCACACAGCCGGCAG

CCCTGGTCAGCAGTTCGGGCTCAGCAAGCACCCTGGCGTCTGCAATCAATGCCGACCTTCCCATTGCCACCGCCTCGGCCGACGTGGCCGCAGACATTGC

CAAGTACACCAGCAAA - UNI7428 - - UNI15537 - - UNI32699 - ATGATGGATGCCATAAAGGGGACGATGACAGAAATCTACAATGAC

CTCTCCAAGAACACCACTGGGAGCACAATAGCTGAG - UNI28133 - - UNI32699 - ATTCGAAGGCTGAGGATTGAGATTGAGAAACTGCAGT

GGCTGCACCAGCAGGAGCTCGCTGAGATGAAGCACAACCTGG - UNI28132 - AGTTGACCATGGCCGAGATGCGGCAGAGCCTGGAACAGGAGCGG

GATCGGCTCATTGCCGAGGTGAAAAAGCAACTGGAGCTGGAGAAGCAGCAGGCGGTGGACGAGACCAAGAAGAAGCAGTGGTGTGCCAACTGCAAGAAGG

AGGCCATTTTCTACTGCTGCTGGAACACCAGCTACTGTGACTACCCCTGTCAGCAGGCCCACTGGCCCGAGCACATGAAGTCCTGTACCCAGTCGG - U

NI12375 - - UNI18789 - - UNI21885 - CGACTGCCCCTCAGCAGGAAGCAGATGCCGAGGCAAGCACAGAAACAGGAAATAAGTCATCGCA

GGGCAACTCCTCCAACACACAGTCAGCACCTTCAGAACCGGCCAGCGCCCCCAAAGAGAAAGAGGCGCCAGCGGAGAAGAGCAAGGACAGTAGTAACTCG

 - UNI21885 - ACCCTGGATCTTTCCGGCTCCAGAGAGACGCCCTCCTCTATGCTCTTAGGCTCCAATCAAAGCTCTG - UNI729 - TTAGCAA

GAGGTGTGACAAGCAGCCTGCCTATACCCCAACCACTACAGACCACCAGCCGCACCCCAACTACCCAGCCCAGAAGT ACCATTCCCGGAGCAGCAAGGC

AGGTTTGTGGAGCAGCAGCGAGGAGAAGCGAGCGTCATCCCGCTCTGAGCACAGTGGAGGGACCAGCACGAAGAACCTCATGCCCAAAGAGTCCCGGGAG

TCTCGGCTAGATGCCTTCTGGGACTAGGGGTGCATTGTGAGCCAGAACACCTCCCTATAGGCGGGAGAAACAGCCCAAACCACAGGAAGCAACAGAAACT

GGAGAACCGCCACCTTTAGAATTTCCAACACTCAGGCTCTGCCCGTCGGCTTGGCTGCAGGACAGAGACTTGACTCCATCCCAGCTCTGGTCTTGGCTGG

GATGGCACTACCCTGTGAGCCAAACACTTTAGGTGTAAGTAGGTACACTTGTGACGTCACTGACCTAGCGTACCTTTCCTTTTCATATCTACACTGACCT

TAACTTATAAAAAAAACAGAAAAGAAAAGCAAGTTTTATATATATACATATATATATAAAGATCTACAATTAAAAGAATGTTTTGATAATCCAGGGGCTG

GTTAGTGAGCCCGCTGGCCTCACTGGGGTGTCAGGGCTGGGCCCAGGGATTGCTATTTTCACGTAGGCCCTTGTCCTTGGATACCCAGGGGAGGGAGCCA

CTGTCGCCGCAGCACACCAGGATTGGGGCTCTCAGGCTGTGCTGCCCTAGACCCGCCACACCAAGCCATCCGCCCCTCACAGACCCTACAAGACGATGTT

AGGAAACACATGCTTGCTGGCCTTGAAGGACACAGAGAGAAGTATGTGTGTGTGGTGTGTTTCCAGCTCTGGCTCCCGAAGGGGCAAAGCAGCCTCCTGT

TTACAGAAGGTCCACGCGAGCTATCCCCGTGGCGTTACGAATGCAGCCAGCGCCCGGCGTTTGTGCAGGGGTGTCGGGAACGAACGCAGCCAGCGGGCAT

CTGTGCGTGCGAGGAGACCCCTTCTCTCGGCCAAGTTTTTTCCCATAACACCCACATGGATTTGTGAAGACGTGCTTCTCAGAAGCAAGGACTCAAAAAG

CAAAGGTGCACGGCGAGGCCACGAAGCCCACGCCAGCCCGGGGATGGAGCATGTATGTATTATTTATCTGCTGGAGTTCTACGTTTTTATGTAAGCATGA

AACACAGGCAGTGTGAGAGAAAGCCAGGACCCGACATGCTGTCCGTTAACGCTACGTCTGCTGTAGTTCCATTTTGTATGTTGTGTAAAGCGAGCATCGA

TCGAAGCAAAAGGTGATGTGTGTATATCAGAAAAAAGAAATTAACTGTATATCATTCCAGTACATTCCGTTGTACATTTTAGTCTCCGTTTACTTTCTCT

TCATTGTTGATAAGAGAATGCCAAGCTGCGCGTTGTTCAGGCAGTTTACCCCTACTAGAGAAGAAAGGAAGAAACGCTAGAAGAAAACAGGAGAGAGAGA

AAATTTGTGAATTGCGGTCGTCAAAACAAAACAAAACAAACAAAAAAAAACAATCTAGCCTAGCTGGCCTTATTTGGGAAGCGTAACTGCTTTTAGCATA

TGGGAGTATTTTTTCACATTTTCTTTGTATAAAATTTGTATTAAACTTAAATATCTTTTTTG
Translation
 - UNI3682 - - UNI12801 - - UNI15045 - - UNI15763 - - UNI29489 - - UNI29535 - MDISTRSKD - UNI5223 - 

- UNI12801 - - UNI12811 - - UNI14301 - - UNI15045 - - UNI15763 - DPVSTEKTAPKRRFPSPPHSSNGHSPQDSSTSPIK

KKKKPGLLNSSNKEQ - UNI7754 - - UNI12811 - - UNI14301 - - UNI25158 - DGRNDFYCWVCHREGQVLCCELCPRVYHAKCLR

LTSEPEGDWFCPECE - UNI25158 - KITVAECIETQSKAMTMLTIEQLSYLLKFAIQKMKQPG - UNI24744 - TDAFQKPVPLEQHPDYAEY

IFHPMDLCTLEK NAKKKMYGCTEAFLADAKWILHNCIIYNGG GNHKLTQIAKVVIKICEHE MNEIEVCPECYLAACQKRDNWFCEPC - UNI3669

 - - UNI29610 - SNPHPLVWAKLKGFPFWPAKALRDKDGQVDARFFGQHDR - UNI5045 - - UNI12805 - - UNI29610 - - UNI3

3792 - RAWVPVNNCYLMSKEIPFSVKKTKSIFNSAMQEMEVYVENIRRKFGVFNYSPFRTPYTPNNQYQMLLDPSNPSAGTAKTDKQEKVKLNFDMTA

SPKILLSKPLLSGGAGRRISLSDMPRSPTSTNSSVHTGSDVEQDPEKKAPSSHFSASEESMDFLDKSTA - UNI5045 - - UNI6317 - - UNI2

9610 - - UNI33792 - - UNI36697 - ASPASTKTGQAGSLSGSPKPFSPQAPTPIMTKPDKTSTSTTGSILNLNLD - UNI144 - - UNI

6317 - - UNI31684 - - UNI33792 - - UNI36697 - DRSKAEMDLKELSESVQQQSAPVPLISPKRQIRSRFQLNLDKTIESCKAQLG -

 UNI113 - - UNI144 - - UNI14944 - - UNI15535 - - UNI31684 - - UNI36697 - GINEISEDVYTAVEHSDSEDSEKSESS

DSEYVSDEEQKPKNEPEDPEDKEGSRVDKEAPAIKRKPKPTNQVEVKEEAKSNSPVSEKPDPTPAKDKASPEPEKDFVEKAKPSPHPTKDKLKGKDETDS

PTVHLGLDSDSESELVIDLGEDPSGREGRKNKKDPKVPSPKQDA - UNI113 - - UNI238 - - UNI14944 - - UNI15535 - - UNI15

537 - - UNI21114 - - UNI31684 - AIGKPPPSSTSAGNQSPPETPVLTRSATQAPAAGVTVAAATTSTMSTVTVTAPATAVTGSPVKKQRPL

LPKETVPAVQRVVWNASSKFQTSSQKWHMQKIQRQQQQQQQQQQSQQQSQQQQPQSSQGTRYQTRQAVKA - UNI238 - - UNI7428 - - UNI1

5535 - - UNI15537 - - UNI21114 - - UNI32699 - AVQQKEVTQSPSTSTITLVTSTQPAALVSSSGSASTLASAINADLPIATASADV

AADIAKYTSK - UNI7428 - - UNI15537 - - UNI32699 - MMDAIKGTMTEIYNDLSKNTTGSTIAE - UNI28133 - - UNI32699

 - IRRLRIEIEKLQWLHQQELAEMKHNLE - UNI28132 - ELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCW

NTSYCDYPCQQAHWPEHMKSCTQSA - UNI12375 - - UNI18789 - - UNI21885 - ATAPQQEADAEASTETGNKSSQGNSSNTQSAPSEP

ASAPKEKEAPAEKSKDSSNS - UNI21885 - TLDLSGSRETPSSMLLGSNQSSV - UNI729 - VSKRCDKQPAYTPTTTDHQPHPNYPAQKY Y

HSRSSKAGLWSSSEEKRASSRSEHSGGTSTKNLMPKESRESRLDAFWD
Transcript ENSMUST00000018050
Sequence
CGGCTTTACACTCCGATTGGCCGGGGCAGCCAATCGGGGATGAGCTTTTATTAGGCGGCCAGATCATCAGCCGAAGTGCCAAACCCTTTTTCTGTGAGAA

CTAGGAGCCTGTCCTCCATGTTTTATAAGTATTGACATTACACAGTTAACAATGCATCCACAGAG - UNI15618 - - UNI29535 - - UNI297

69 - - UNI30294 - TCCCAAATCTGCCAGCCTGTCCTCTCCTCCTAACTGGGGAAAAGTGAGACGGTTGCTTGAACGTGTGTTGG - UNI3682 

- - UNI12801 - - UNI15045 - - UNI15763 - - UNI29489 - - UNI29535 - - UNI29769 - CTTGGCTGAAGAGGAAATAA

AAACCGAGCAGGAGGTGGTGGAGGGAATGGATATCTCTACTCGCTCCAAAG - UNI5223 - - UNI12801 - - UNI12811 - - UNI14301

 - - UNI15045 - - UNI15763 - ATCCTGTCTCTACAGAGAAAACGGCCCCGAAACGGAGGTTCCCCAGCCCTCCACATTCCTCCAATGGCCAT

TCGCCCCAAGACTCATCCACGAGCCCCATTAAAAAGAAAAAGAAACCCGGCTTACTCAACAGTAGCAATAAGGAACAG - UNI7754 - - UNI1281

1 - - UNI14301 - TCAGAGCTAAGACATGGTCCGTTTTACTATATGAAGCAGCCACTCACCACAGACCCTGTTGATGTTGTACCGCAGGACGGACG

GAATGACTTCTATTGCTGGGTTTGTCACCGGGAAGGACAAGTCCTTTGCTGTGAGCTCTGTCCCCGGGTTTATCACGCTAAGTGTCTGAGACTGACATCG

GAGCCAGAGGGGGACTGGTTTTGTCCTGAATGTGAG - UNI25158 - AAGATTACAGTAGCAGAATGCATCGAGACGCAGAGCAAAGCCATGACCAT

GCTGACCATTGAACAACTGTCCTACCTGCTCAAGTTTGCCATTCAGAAAATGAAGCAGCCAGGG - UNI24744 - ACGGATGCATTCCAGAAGCCTG

TTCCATTGGAGCAACACCCTGACTATGCAGAATATATTTTCCACCCCATGGACCTTTGTACATTGGAAAAG AATGCAAAAAAGAAGATGTACGGCTGCA

CAGAAGCCTTCCTGGCCGATGCCAAGTGGATCCTGCACAACTGCATTATTTATAATGGGG GAAATCACAAGTTGACGCAAATAGCAAAAGTCGTCATCA

AAATCTGTGAGCACGAG ATGAATGAAATCGAAGTCTGTCCAGAATGTTATCTTGCAGCTTGCCAAAAACGAGACAACTGGTTCTGTGAGCCCTGT - U

NI3669 - - UNI29610 - AGCAATCCGCACCCTTTGGTCTGGGCAAAACTGAAAGGATTTCCATTCTGGCCAGCGAAAGCTCTGAGGGACAAAGAC

GGGCAGGTTGACGCCCGTTTCTTTGGACAACATGACAG - UNI5045 - - UNI12805 - - UNI29610 - - UNI33792 - AGCCTGGGTT

CCAGTCAATAATTGCTACCTCATGTCTAAAGAAATCCCCTTTTCTGTGAAAAAGACTAAAAGTATCTTCAACAGCGCCATGCAAGAGATGGAAGTTTACG

TGGAGAACATACGGAGGAAGTTTGGGGTTTTTAATTACTCCCCGTTCAGGACGCCCTACACGCCCAACAACCAGTACCAAATGCTGCTGGATCCCAGCAA

CCCCAGCGCGGGCACAGCCAAGACAGACAAACAGGAGAAGGTGAAGCTTAATTTTGACATGACAGCGTCCCCCAAGATCCTTCTGAGCAAGCCCCTTCTG

AGCGGGGGTGCCGGCCGCAGGATCTCCCTGTCCGACATGCCTCGCTCCCCCACCAGTACGAACTCTTCCGTGCACACGGGCTCCGATGTGGAGCAGGACC

CCGAGAAGAAGGCCCCGTCCAGCCACTTCAGCGCAAGCGAGGAGTCCATGGACTTCCTTGATAAGAGCACAG - UNI5045 - - UNI6317 - - U

NI29610 - - UNI33792 - - UNI36697 - CTTCTCCAGCCTCCACCAAGACGGGGCAAGCCGGGAGCTTGTCTGGCAGCCCAAAGCCTTTCTC

TCCGCAAGCGCCGACACCCATCATGACAAAACCCGACAAGACTTCCACCTCCACCACCGGGAGCATCCTGAACCTGAACTTGG - UNI144 - - UNI

6317 - - UNI31684 - - UNI33792 - - UNI36697 - ATCGAAGCAAGGCCGAGATGGACCTGAAGGAGCTGAGCGAGTCGGTCCAGCAGC

AGTCAGCCCCCGTCCCTCTCATCTCTCCCAAGCGGCAGATTCGAAGCCGGTTCCAGCTCAACCTGGACAAGACCATAGAGAGTTGCAAAGCACAGCTAG 

- UNI113 - - UNI144 - - UNI14944 - - UNI15535 - - UNI31684 - - UNI36697 - GCATAAATGAGATCTCAGAGGATGTT

TATACAGCCGTGGAGCACAGCGATTCCGAGGACTCCGAAAAGTCGGAGAGCAGCGACAGCGAGTACGTCAGCGATGAGGAACAGAAGCCCAAGAATGAGC

CCGAGGACCCCGAGGACAAAGAGGGGAGTCGGGTGGACAAAGAGGCCCCTGCCATCAAAAGGAAGCCCAAACCCACAAACCAGGTAGAGGTCAAAGAGGA

AGCGAAGAGCAACTCTCCTGTCAGCGAGAAGCCGGACCCCACACCCGCCAAGGACAAGGCCAGCCCAGAGCCTGAGAAGGACTTTGTAGAGAAAGCAAAG

CCATCACCTCATCCCACAAAGGACAAACTGAAAGGAAAGGATGAAACGGATTCTCCCACAGTGCACTTGGGCTTGGATTCGGACTCGGAGAGCGAACTTG

TCATAGACTTAGGAGAGGATCCTTCTGGGAGGGAGGGTCGAAAAAACAAGAAAGATCCCAAGGTGCCGTCGCCTAAGCAAGACG - UNI113 - - UN

I238 - - UNI14944 - - UNI15535 - - UNI15537 - - UNI21114 - - UNI31684 - CTATAGGTAAACCGCCACCGTCGTCCAC

TTCGGCGGGCAACCAGTCTCCCCCAGAGACACCGGTACTCACCCGCTCAGCCACCCAAGCACCCGCGGCTGGGGTCACCGTGGCCGCCGCCACCACCAGC

ACGATGTCTACCGTCACAGTCACGGCACCGGCCACCGCCGTCACGGGAAGCCCGGTGAAGAAGCAGAGGCCGCTCTTACCGAAGGAGACTGTCCCAGCTG

TGCAGCGGGTCGTGTGGAACGCATCAA - UNI238 - - UNI7428 - - UNI14944 - - UNI15535 - - UNI15537 - - UNI21114

 - - UNI32699 - CTGTCCAGCAGAAGGAGGTCACCCAGAGCCCATCCACGTCCACCATCACGCTGGTGACCAGCACACAGCCGGCAGCCCTGGTCA

GCAGTTCGGGCTCAGCAAGCACCCTGGCGTCTGCAATCAATGCCGACCTTCCCATTGCCACCGCCTCGGCCGACGTGGCCGCAGACATTGCCAAGTACAC

CAGCAAA - UNI7428 - - UNI15537 - - UNI32699 - ATGATGGATGCCATAAAGGGGACGATGACAGAAATCTACAATGACCTCTCCAAG

AACACCACTGGGAGCACAATAGCTGAG - UNI28133 - - UNI32699 - ATTCGAAGGCTGAGGATTGAGATTGAGAAACTGCAGTGGCTGCACC

AGCAGGAGCTCGCTGAGATGAAGCACAACCTGG - UNI28132 - AGTTGACCATGGCCGAGATGCGGCAGAGCCTGGAACAGGAGCGGGATCGGCTC

ATTGCCGAGGTGAAAAAGCAACTGGAGCTGGAGAAGCAGCAGGCGGTGGACGAGACCAAGAAGAAGCAGTGGTGTGCCAACTGCAAGAAGGAGGCCATTT

TCTACTGCTGCTGGAACACCAGCTACTGTGACTACCCCTGTCAGCAGGCCCACTGGCCCGAGCACATGAAGTCCTGTACCCAGTCGG - UNI12375 -

 - UNI18789 - - UNI21885 - CGACTGCCCCTCAGCAGGAAGCAGATGCCGAGGCAAGCACAGAAACAGGAAATAAGTCATCGCAGGGCAACTC

CTCCAACACACAGTCAGCACCTTCAGAACCGGCCAGCGCCCCCAAAGAGAAAGAGGCGCCAGCGGAGAAGAGCAAGGACAGTAGTAACTCG - UNI218

85 - ACCCTGGATCTTTCCGGCTCCAGAGAGACGCCCTCCTCTATGCTCTTAGGCTCCAATCAAAGCTCTG - UNI729 - TTAGCAAGAGGTGTGA

CAAGCAGCCTGCCTATACCCCAACCACTACAGACCACCAGCCGCACCCCAACTACCCAGCCCAGAAGT ACCATTCCCGGAGCAGCAAGGCAGGTTTGTG

GAGCAGCAGCGAGGAGAAGCGAGCGTCATCCCGCTCTGAGCACAGTGGAGGGACCAGCACGAAGAACCTCATGCCCAAAGAGTCCCGGGAGTCTCGGCTA

GATGCCTTCTGGGACTAGGGGTGCATTGTGAGCCAGAACACCTCCCTATAGGCGGGAGAAACAGCCCAAACCACAGGAAGCAACAGAAACTGGAGAACCG

CCACCTTTAGAATTTCCAACACTCAGGCTCTGCCCGTCGGCTTGGCTGCAGGACAGAGACTTGACTCCATCCCAGCTCTGGTCTTGGCTGGGATGGCACT

ACCCTGTGAGCCAAACACTTTAGGTGTAAGTAGGTACACTTGTGACGTCACTGACCTAGCGTACCTTTCCTTTTCATATCTACACTGACCTTAACTTATA

AAAAAAACAGAAAAGAAAAGCAAGTT
Translation
 - UNI15618 - - UNI29535 - - UNI29769 - - UNI30294 -  - UNI3682 - - UNI12801 - - UNI15045 - - UNI157

63 - - UNI29489 - - UNI29535 - - UNI29769 - MDISTRSKD - UNI5223 - - UNI12801 - - UNI12811 - - UNI143

01 - - UNI15045 - - UNI15763 - DPVSTEKTAPKRRFPSPPHSSNGHSPQDSSTSPIKKKKKPGLLNSSNKEQ - UNI7754 - - UNI1

2811 - - UNI14301 - SELRHGPFYYMKQPLTTDPVDVVPQDGRNDFYCWVCHREGQVLCCELCPRVYHAKCLRLTSEPEGDWFCPECE - UNI2

5158 - KITVAECIETQSKAMTMLTIEQLSYLLKFAIQKMKQPG - UNI24744 - TDAFQKPVPLEQHPDYAEYIFHPMDLCTLEK NAKKKMYGC

TEAFLADAKWILHNCIIYNGG GNHKLTQIAKVVIKICEHE MNEIEVCPECYLAACQKRDNWFCEPC - UNI3669 - - UNI29610 - SNPHPL

VWAKLKGFPFWPAKALRDKDGQVDARFFGQHDR - UNI5045 - - UNI12805 - - UNI29610 - - UNI33792 - RAWVPVNNCYLMSKE

IPFSVKKTKSIFNSAMQEMEVYVENIRRKFGVFNYSPFRTPYTPNNQYQMLLDPSNPSAGTAKTDKQEKVKLNFDMTASPKILLSKPLLSGGAGRRISLS

DMPRSPTSTNSSVHTGSDVEQDPEKKAPSSHFSASEESMDFLDKSTA - UNI5045 - - UNI6317 - - UNI29610 - - UNI33792 - - 

UNI36697 - ASPASTKTGQAGSLSGSPKPFSPQAPTPIMTKPDKTSTSTTGSILNLNLD - UNI144 - - UNI6317 - - UNI31684 - - 

UNI33792 - - UNI36697 - DRSKAEMDLKELSESVQQQSAPVPLISPKRQIRSRFQLNLDKTIESCKAQLG - UNI113 - - UNI144 - -

 UNI14944 - - UNI15535 - - UNI31684 - - UNI36697 - GINEISEDVYTAVEHSDSEDSEKSESSDSEYVSDEEQKPKNEPEDPEDK

EGSRVDKEAPAIKRKPKPTNQVEVKEEAKSNSPVSEKPDPTPAKDKASPEPEKDFVEKAKPSPHPTKDKLKGKDETDSPTVHLGLDSDSESELVIDLGED

PSGREGRKNKKDPKVPSPKQDA - UNI113 - - UNI238 - - UNI14944 - - UNI15535 - - UNI15537 - - UNI21114 - - U

NI31684 - AIGKPPPSSTSAGNQSPPETPVLTRSATQAPAAGVTVAAATTSTMSTVTVTAPATAVTGSPVKKQRPLLPKETVPAVQRVVWNAST - U

NI238 - - UNI7428 - - UNI14944 - - UNI15535 - - UNI15537 - - UNI21114 - - UNI32699 - TVQQKEVTQSPSTST

ITLVTSTQPAALVSSSGSASTLASAINADLPIATASADVAADIAKYTSK - UNI7428 - - UNI15537 - - UNI32699 - MMDAIKGTMTEI

YNDLSKNTTGSTIAE - UNI28133 - - UNI32699 - IRRLRIEIEKLQWLHQQELAEMKHNLE - UNI28132 - ELTMAEMRQSLEQERDR

LIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSA - UNI12375 - - UNI18789 - - UNI2188

5 - ATAPQQEADAEASTETGNKSSQGNSSNTQSAPSEPASAPKEKEAPAEKSKDSSNS - UNI21885 - TLDLSGSRETPSSMLLGSNQSSV - U

NI729 - VSKRCDKQPAYTPTTTDHQPHPNYPAQKY YHSRSSKAGLWSSSEEKRASSRSEHSGGTSTKNLMPKESRESRLDAFWD
Transcript ENSMUST00000109269
Sequence
AAAGTATTTTCTCCAGCTGCAGTTTTCTTTCTAAAGATTGTTATTTGGCTGCCCGCCCCCTACTTCCACCCCACAATCTCTAAACAGCTCTTAAACTAAA

TTGCCCAAGATCTGTGGGGGCATTTGGAAAGATACGACTCTTTCTCATCAGCACTTTTGATATGATTATTTATAGTTCTTCCTTTCCAGTAACACACCCG

GGCTTAACCCTGAGCAACAACAACAACAACAGAAAGAAAAAGCAAAAGAGAAAGAAAGCCGAGATTGTGGTGTGGGCAAAGGGTAGGCCCTCAGATGTGG

CTGTTCAAAATGACTAGTTTTGAATTTTGGTCTTTGCTTTTGTAAACCAAGTATTCTTTCTTTCTCTTCCCCCACCCCCTTTAAATTCAGACACTGCAAT

CGTCAATGTAGTCAAATACAAGTTGTGCACTTGTGCGTGCATGTGTGATGTGTGTGTGTGTGTGCACACATGTACTCGCACAGATGGGGGTTGCCTTTGA

AGGGATGGCTTGCAGTTGTGGGAAAAAGATGGTTTTCCTCAGTAGTGCTGGAAGATTCTAGGCTCAAAAATTGATGGTGCTGTTGCTAAGTCAGGTGGCT

GTGGCGGTCACTTGTGATGCTTGGGGAGATGAAACAGCTTACCCCCCACTTCTGTTTCAGAATTGATTATCTTAAACTCAGCAGCCACCACGAAACTGCT

TTGCATTTTCCTTGCTTCTCAGCTGCATTCCTGCCTGAAGTATTCAGCCACGTAATTGTTCTCTTCAGTGCGGGTCCTCTTCCTTGATCAATACACCTTT

GACTGTTTCCATCATAGCAGAAATCCTTCAAGTGGGTCTCCAGTCTTTTGTGTGTGTGTGTGTGTGTGTTGTATGTTAGCTCTGAGATTCATAATTGTTT

CTTTCCCCACTGGTACTTTTCAGTTGGAGCACAAATTAGTGTTGTACCTCATCGCTCGTTCAAAATATGGGCGGGATCCATTTTTCATGCCTCATGCTAG

AGAGGGCAACAGAATGCCAGTTGCTAGGAAGATCAAGGTTATGGGCTGTGCTTTTAAAGTTAACCATCTACCTCACCTCTGGCTGCAAGAACCGCCCTTT

CAGCAGCACCCAGGCAGATGACCAGTGTGGTTCAGGCAGTGTTTCTGAGTTGCAGGTGTTCTCCTGAAGCTGGAGTAGAAGGTGCATCTTGTCCATGTCC

CCTGGATTGTTCCATGTTGGTGACATGCTCAGGTCTGGCAATCAGGCTTCTTTTGAGAAGGATCACCTGTGAACAATGTGTCATTATCTCCTTGGTGATT

TGGGACATTGGTCTCTCTACAGATAGATGCAGACTAAATGAAATTGTTACCTAGGCTCTGTATCAGAATGCTAAGTGTGTTAATTTTCAAATTTAGACCC

AAACTACCTTTCTCTCTCTTCTCTCTTGGGACTAGTTAAAGTCAGGGGACTCTCAGCTCCTGTCGTGTGCAATAATCTTTTCTTTTTCTGCCTAGTTCCT

GTCTTGAGTTTTGTCCTCCCCTACACACCTGGAGCTCTCCCAAACAGGACTCCATCTTACCCCAAGCTTCCAGGCTGGAGGCTGCCTTTCTGACACAGAG

CACGGGACGCAGACAGCACAGCCTTCTCAGCTGTTTTCCTCTCTTGCCTTCCCAATGGAAAATTCCAGCCATGTCCATTGGTGATGCGCCTATTTTCTTC

TTGCTGAACCCTGCTCTGCTGGGATGGCACCTAGAGCGGTTGCTTAGCATCTCCCTAAAGCAGCATCTTGGAATGCCTGAGACATTCTAGCACTTGCCTA

TAACAGCAGCTCTATCTGCTTTTCCTTCTGCTTGGCTTGTGAAGTGTTAGGTTGACAGGGCCTGCTCTGTTGAACCTGTGTTCCAACGGGGAGGCAGAGA

AGGTTCTGGGTGACAGACCTTCCTAGCTAAGGGGGGCCTGCCTTTCTCCTTTCTTAGCCCAGCTTTCCACTCAGCCTGCGTCCTTTAAATAATCCTTCCT

CATTCCACTCTCTGTGCTGAAGTGTAATTAGTCACAGTTCAGAAGGAAGCCATGCCTGGTGGGATTGAGACTGCCCAGAGACCCTAGGGTCCTGATGCCT

GTGATAAAGGCTGCTAGAATCTGGCCATGTTTTTCTACTTTGTAATTTAACCG - UNI3682 - - UNI12801 - - UNI15045 - - UNI157

63 - - UNI29489 - CTTGGCTGAAGAGGAAATAAAAACCGAGCAGGAGGTGGTGGAGGGAATGGATATCTCTACTCGCTCCAAAG - UNI5223 

- - UNI12801 - - UNI14301 - - UNI15045 - - UNI15763 - AACCTAAGGAAG - UNI12811 - - UNI14301 - - UNI15

045 - ATCCTGTCTCTACAGAGAAAACGGCCCCGAAACGGAGGTTCCCCAGCCCTCCACATTCCTCCAATGGCCATTCGCCCCAAGACTCATCCACGAG

CCCCATTAAAAAGAAAAAGAAACCCGGCTTACTCAACAGTAGCAATAAGGAACAG - UNI7754 - - UNI12811 - - UNI14301 - TCAGAG

CTAAGACATGGTCCGTTTTACTATATGAAGCAGCCACTCACCACAGACCCTGTTGATGTTGTACCGCAGGACGGACGGAATGACTTCTATTGCTGGGTTT

GTCACCGGGAAGGACAAGTCCTTTGCTGTGAGCTCTGTCCCCGGGTTTATCACGCTAAGTGTCTGAGACTGACATCGGAGCCAGAGGGGGACTGGTTTTG

TCCTGAATGTGAG - UNI25158 - AAGATTACAGTAGCAGAATGCATCGAGACGCAGAGCAAAGCCATGACCATGCTGACCATTGAACAACTGTCCT

ACCTGCTCAAGTTTGCCATTCAGAAAATGAAGCAGCCAGGG - UNI24744 - ACGGATGCATTCCAGAAGCCTGTTCCATTGGAGCAACACCCTGAC

TATGCAGAATATATTTTCCACCCCATGGACCTTTGTACATTGGAAAAG AATGCAAAAAAGAAGATGTACGGCTGCACAGAAGCCTTCCTGGCCGATGCC

AAGTGGATCCTGCACAACTGCATTATTTATAATGGGG GAAATCACAAGTTGACGCAAATAGCAAAAGTCGTCATCAAAATCTGTGAGCACGAG ATGAA

TGAAATCGAAGTCTGTCCAGAATGTTATCTTGCAGCTTGCCAAAAACGAGACAACTGGTTCTGTGAGCCCTGT - UNI3669 - - UNI29610 - A

GCAATCCGCACCCTTTGGTCTGGGCAAAACTGAAAGGATTTCCATTCTGGCCAGCGAAAGCTCTGAGGGACAAAGACGGGCAGGTTGACGCCCGTTTCTT

TGGACAACATGACAG - UNI5045 - - UNI12805 - - UNI29610 - - UNI33792 - AGCCTGGGTTCCAGTCAATAATTGCTACCTCAT

GTCTAAAGAAATCCCCTTTTCTGTGAAAAAGACTAAAAGTATCTTCAACAGCGCCATGCAAGAGATGGAAGTTTACGTGGAGAACATACGGAGGAAGTTT

GGGGTTTTTAATTACTCCCCGTTCAGGACGCCCTACACGCCCAACAACCAGTACCAAATGCTGCTGGATCCCAGCAACCCCAGCGCGGGCACAGCCAAGA

CAGACAAACAGGAGAAGGTGAAGCTTAATTTTGACATGACAGCGTCCCCCAAGATCCTTCTGAGCAAGCCCCTTCTGAGCGGGGGTGCCGGCCGCAGGAT

CTCCCTGTCCGACATGCCTCGCTCCCCCACCAGTACGAACTCTTCCGTGCACACGGGCTCCGATGTGGAGCAGGACCCCGAGAAGAAGGCCCCGTCCAGC

CACTTCAGCGCAAGCGAGGAGTCCATGGACTTCCTTGATAAGAGCACAG - UNI5045 - - UNI6317 - - UNI29610 - - UNI33792 - 

- UNI36697 - CTTCTCCAGCCTCCACCAAGACGGGGCAAGCCGGGAGCTTGTCTGGCAGCCCAAAGCCTTTCTCTCCGCAAGCGCCGACACCCATCA

TGACAAAACCCGACAAGACTTCCACCTCCACCACCGGGAGCATCCTGAACCTGAACTTGG - UNI144 - - UNI6317 - - UNI31684 - - U

NI33792 - - UNI36697 - ATCGAAGCAAGGCCGAGATGGACCTGAAGGAGCTGAGCGAGTCGGTCCAGCAGCAGTCAGCCCCCGTCCCTCTCATC

TCTCCCAAGCGGCAGATTCGAAGCCGGTTCCAGCTCAACCTGGACAAGACCATAGAGAGTTGCAAAGCACAGCTAG - UNI113 - - UNI144 - -

 UNI14944 - - UNI15535 - - UNI31684 - - UNI36697 - GCATAAATGAGATCTCAGAGGATGTTTATACAGCCGTGGAGCACAGCGA

TTCCGAGGACTCCGAAAAGTCGGAGAGCAGCGACAGCGAGTACGTCAGCGATGAGGAACAGAAGCCCAAGAATGAGCCCGAGGACCCCGAGGACAAAGAG

GGGAGTCGGGTGGACAAAGAGGCCCCTGCCATCAAAAGGAAGCCCAAACCCACAAACCAGGTAGAGGTCAAAGAGGAAGCGAAGAGCAACTCTCCTGTCA

GCGAGAAGCCGGACCCCACACCCGCCAAGGACAAGGCCAGCCCAGAGCCTGAGAAGGACTTTGTAGAGAAAGCAAAGCCATCACCTCATCCCACAAAGGA

CAAACTGAAAGGAAAGGATGAAACGGATTCTCCCACAGTGCACTTGGGCTTGGATTCGGACTCGGAGAGCGAACTTGTCATAGACTTAGGAGAGGATCCT

TCTGGGAGGGAGGGTCGAAAAAACAAGAAAGATCCCAAGGTGCCGTCGCCTAAGCAAGACG - UNI113 - - UNI238 - - UNI14944 - - U

NI15535 - - UNI15537 - - UNI21114 - - UNI31684 - CTATAGGTAAACCGCCACCGTCGTCCACTTCGGCGGGCAACCAGTCTCCCC

CAGAGACACCGGTACTCACCCGCTCAGCCACCCAAGCACCCGCGGCTGGGGTCACCGTGGCCGCCGCCACCACCAGCACGATGTCTACCGTCACAGTCAC

GGCACCGGCCACCGCCGTCACGGGAAGCCCGGTGAAGAAGCAGAGGCCGCTCTTACCGAAGGAGACTGTCCCAGCTGTGCAGCGGGTCGTGTGGAACGCA

TCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATACAGCGCCAGCAGCAGCAGCAGCAACAACAACAGCAGAGCCAACAGCAGAGCC

AGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAGGCTGTGAAAG - UNI238 - - UNI7428 - - UNI15535 - - U

NI15537 - - UNI21114 - - UNI32699 - CTGTCCAGCAGAAGGAGGTCACCCAGAGCCCATCCACGTCCACCATCACGCTGGTGACCAGCAC

ACAGCCGGCAGCCCTGGTCAGCAGTTCGGGCTCAGCAAGCACCCTGGCGTCTGCAATCAATGCCGACCTTCCCATTGCCACCGCCTCGGCCGACGTGGCC

GCAGACATTGCCAAGTACACCAGCAAA - UNI7428 - - UNI15537 - - UNI32699 - ATGATGGATGCCATAAAGGGGACGATGACAGAAA

TCTACAATGACCTCTCCAAGAACACCACTGGGAGCACAATAGCTGAG - UNI28133 - - UNI32699 - ATTCGAAGGCTGAGGATTGAGATTGA

GAAACTGCAGTGGCTGCACCAGCAGGAGCTCGCTGAGATGAAGCACAACCTGG - UNI28132 - AGTTGACCATGGCCGAGATGCGGCAGAGCCTGG

AACAGGAGCGGGATCGGCTCATTGCCGAGGTGAAAAAGCAACTGGAGCTGGAGAAGCAGCAGGCGGTGGACGAGACCAAGAAGAAGCAGTGGTGTGCCAA

CTGCAAGAAGGAGGCCATTTTCTACTGCTGCTGGAACACCAGCTACTGTGACTACCCCTGTCAGCAGGCCCACTGGCCCGAGCACATGAAGTCCTGTACC

CAGTCGG - UNI12375 - - UNI18789 - - UNI21885 - CGACTGCCCCTCAGCAGGAAGCAGATGCCGAGGCAAGCACAGAAACAGGAAAT

AAGTCATCGCAGGGCAACTCCTCCAACACACAGTCAGCACCTTCAGAACCGGCCAGCGCCCCCAAAGAGAAAGAGGCGCCAGCGGAGAAGAGCAAGGACA

GTAGTAACTCG - UNI21885 - ACCCTGGATCTTTCCGGCTCCAGAGAGACGCCCTCCTCTATGCTCTTAGGCTCCAATCAAAGCTCTG - UNI72

9 - TTAGCAAGAGGTGTGACAAGCAGCCTGCCTATACCCCAACCACTACAGACCACCAGCCGCACCCCAACTACCCAGCCCAGAAGT ACCATTCCCGG

AGCAGCAAGGCAGGTTTGTGGAGCAGCAGCGAGGAGAAGCGAGCGTCATCCCGCTCTGAGCACAGTGGAGGGACCAGCACGAAGAACCTCATGCCCAAAG

AGTCCCGGGAGTCTCGGCTAGATGCCTTCTGGGACTAGGGGTGCATTGTGAGCCAGAACACCTCCCTATAGGCGGGAGAAACAGCCCAAACCACAGGAAG

CAACAGAAACTGGAGAACCGCCACCTTTAGAATTTCCAACACTCAGGCTCTGCCCGTCGGCTTGGCTGCAGGACAGAGACTTGACTCCATCCCAGCTCTG

GTCTTGGCTGGGATGGCACTACCCTGTGAGCCAAACACTTTAGGTGTAAGTAGGTACACTTGTGACGTCACTGACCTAGCGTACCTTTCCTTTTCATATC

TACACTGACCTTAACTTAT
Translation
 - UNI3682 - - UNI12801 - - UNI15045 - - UNI15763 - - UNI29489 - MDISTRSKE - UNI5223 - - UNI12801 - 

- UNI14301 - - UNI15045 - - UNI15763 - EPKED - UNI12811 - - UNI14301 - - UNI15045 - DPVSTEKTAPKRRFPS

PPHSSNGHSPQDSSTSPIKKKKKPGLLNSSNKEQ - UNI7754 - - UNI12811 - - UNI14301 - SELRHGPFYYMKQPLTTDPVDVVPQDG

RNDFYCWVCHREGQVLCCELCPRVYHAKCLRLTSEPEGDWFCPECE - UNI25158 - KITVAECIETQSKAMTMLTIEQLSYLLKFAIQKMKQPG -

 UNI24744 - TDAFQKPVPLEQHPDYAEYIFHPMDLCTLEK NAKKKMYGCTEAFLADAKWILHNCIIYNGG GNHKLTQIAKVVIKICEHE MNEIE

VCPECYLAACQKRDNWFCEPC - UNI3669 - - UNI29610 - SNPHPLVWAKLKGFPFWPAKALRDKDGQVDARFFGQHDR - UNI5045 - -

 UNI12805 - - UNI29610 - - UNI33792 - RAWVPVNNCYLMSKEIPFSVKKTKSIFNSAMQEMEVYVENIRRKFGVFNYSPFRTPYTPNNQ

YQMLLDPSNPSAGTAKTDKQEKVKLNFDMTASPKILLSKPLLSGGAGRRISLSDMPRSPTSTNSSVHTGSDVEQDPEKKAPSSHFSASEESMDFLDKSTA

 - UNI5045 - - UNI6317 - - UNI29610 - - UNI33792 - - UNI36697 - ASPASTKTGQAGSLSGSPKPFSPQAPTPIMTKPDKT

STSTTGSILNLNLD - UNI144 - - UNI6317 - - UNI31684 - - UNI33792 - - UNI36697 - DRSKAEMDLKELSESVQQQSAPV

PLISPKRQIRSRFQLNLDKTIESCKAQLG - UNI113 - - UNI144 - - UNI14944 - - UNI15535 - - UNI31684 - - UNI3669

7 - GINEISEDVYTAVEHSDSEDSEKSESSDSEYVSDEEQKPKNEPEDPEDKEGSRVDKEAPAIKRKPKPTNQVEVKEEAKSNSPVSEKPDPTPAKDKA

SPEPEKDFVEKAKPSPHPTKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDPSGREGRKNKKDPKVPSPKQDA - UNI113 - - UNI238 - - 

UNI14944 - - UNI15535 - - UNI15537 - - UNI21114 - - UNI31684 - AIGKPPPSSTSAGNQSPPETPVLTRSATQAPAAGVTV

AAATTSTMSTVTVTAPATAVTGSPVKKQRPLLPKETVPAVQRVVWNASSKFQTSSQKWHMQKIQRQQQQQQQQQQSQQQSQQQQPQSSQGTRYQTRQAVK

A - UNI238 - - UNI7428 - - UNI15535 - - UNI15537 - - UNI21114 - - UNI32699 - AVQQKEVTQSPSTSTITLVTSTQ

PAALVSSSGSASTLASAINADLPIATASADVAADIAKYTSK - UNI7428 - - UNI15537 - - UNI32699 - MMDAIKGTMTEIYNDLSKNT

TGSTIAE - UNI28133 - - UNI32699 - IRRLRIEIEKLQWLHQQELAEMKHNLE - UNI28132 - ELTMAEMRQSLEQERDRLIAEVKKQ

LELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSA - UNI12375 - - UNI18789 - - UNI21885 - ATAP

QQEADAEASTETGNKSSQGNSSNTQSAPSEPASAPKEKEAPAEKSKDSSNS - UNI21885 - TLDLSGSRETPSSMLLGSNQSSV - UNI729 - 

VSKRCDKQPAYTPTTTDHQPHPNYPAQKY YHSRSSKAGLWSSSEEKRASSRSEHSGGTSTKNLMPKESRESRLDAFWD
Transcript ENSMUST00000099083
Sequence
CAAGAACCTAAGGAAG - UNI12811 - - UNI14301 - - UNI15045 - ATCCTGTCTCTACAGAGAAAACGGCCCCGAAACGGAGGTTCCCC

AGCCCTCCACATTCCTCCAATGGCCATTCGCCCCAAGACTCATCCACGAGCCCCATTAAAAAGAAAAAGAAACCCGGCTTACTCAACAGTAGCAATAAGG

AACAG - UNI7754 - - UNI12811 - - UNI14301 - TCAGAGCTAAGACATGGTCCGTTTTACTATATGAAGCAGCCACTCACCACAGACCC

TGTTGATGTTGTACCGCAGGACGGACGGAATGACTTCTATTGCTGGGTTTGTCACCGGGAAGGACAAGTCCTTTGCTGTGAGCTCTGTCCCCGGGTTTAT

CACGCTAAGTGTCTGAGACTGACATCGGAGCCAGAGGGGGACTGGTTTTGTCCTGAATGTGAG - UNI25158 - AAGATTACAGTAGCAGAATGCAT

CGAGACGCAGAGCAAAGCCATGACCATGCTGACCATTGAACAACTGTCCTACCTGCTCAAGTTTGCCATTCAGAAAATGAAGCAGCCAGGG - UNI247

44 - ACGGATGCATTCCAGAAGCCTGTTCCATTGGAGCAACACCCTGACTATGCAGAATATATTTTCCACCCCATGGACCTTTGTACATTGGAAAAG A

ATGCAAAAAAGAAGATGTACGGCTGCACAGAAGCCTTCCTGGCCGATGCCAAGTGGATCCTGCACAACTGCATTATTTATAATGGGG GAAATCACAAGT

TGACGCAAATAGCAAAAGTCGTCATCAAAATCTGTGAGCACGAG ATGAATGAAATCGAAGTCTGTCCAGAATGTTATCTTGCAGCTTGCCAAAAACGAG

ACAACTGGTTCTGTGAGCCCTGT - UNI3669 - - UNI29610 - AGCAATCCGCACCCTTTGGTCTGGGCAAAACTGAAAGGATTTCCATTCTGG

CCAGCGAAAGCTCTGAGGGACAAAGACGGGCAGGTTGACGCCCGTTTCTTTGGACAACATGACAG - UNI5045 - - UNI12805 - - UNI2961

0 - - UNI33792 - AGCCTGGGTTCCAGTCAATAATTGCTACCTCATGTCTAAAGAAATCCCCTTTTCTGTGAAAAAGACTAAAAGTATCTTCAACA

GCGCCATGCAAGAGATGGAAGTTTACGTGGAGAACATACGGAGGAAGTTTGGGGTTTTTAATTACTCCCCGTTCAGGACGCCCTACACGCCCAACAACCA

GTACCAAATGCTGCTGGATCCCAGCAACCCCAGCGCGGGCACAGCCAAGACAGACAAACAGGAGAAGGTGAAGCTTAATTTTGACATGACAGCGTCCCCC

AAGATCCTTCTGAGCAAGCCCCTTCTGAGCGGGGGTGCCGGCCGCAGGATCTCCCTGTCCGACATGCCTCGCTCCCCCACCAGTACGAACTCTTCCGTGC

ACACGGGCTCCGATGTGGAGCAGGACCCCGAGAAGAAGGCCCCGTCCAGCCACTTCAGCGCAAGCGAGGAGTCCATGGACTTCCTTGATAAGAGCACAG 

- UNI5045 - - UNI6317 - - UNI29610 - - UNI33792 - - UNI36697 - CTTCTCCAGCCTCCACCAAGACGGGGCAAGCCGGGAG

CTTGTCTGGCAGCCCAAAGCCTTTCTCTCCGCAAGCGCCGACACCCATCATGACAAAACCCGACAAGACTTCCACCTCCACCACCGGGAGCATCCTGAAC

CTGAACTTGG - UNI144 - - UNI6317 - - UNI31684 - - UNI33792 - - UNI36697 - ATCGAAGCAAGGCCGAGATGGACCTGA

AGGAGCTGAGCGAGTCGGTCCAGCAGCAGTCAGCCCCCGTCCCTCTCATCTCTCCCAAGCGGCAGATTCGAAGCCGGTTCCAGCTCAACCTGGACAAGAC

CATAGAGAGTTGCAAAGCACAGCTAG - UNI113 - - UNI144 - - UNI14944 - - UNI15535 - - UNI31684 - - UNI36697 -

 GCATAAATGAGATCTCAGAGGATGTTTATACAGCCGTGGAGCACAGCGATTCCGAGGACTCCGAAAAGTCGGAGAGCAGCGACAGCGAGTACGTCAGCG

ATGAGGAACAGAAGCCCAAGAATGAGCCCGAGGACCCCGAGGACAAAGAGGGGAGTCGGGTGGACAAAGAGGCCCCTGCCATCAAAAGGAAGCCCAAACC

CACAAACCAGGTAGAGGTCAAAGAGGAAGCGAAGAGCAACTCTCCTGTCAGCGAGAAGCCGGACCCCACACCCGCCAAGGACAAGGCCAGCCCAGAGCCT

GAGAAGGACTTTGTAGAGAAAGCAAAGCCATCACCTCATCCCACAAAGGACAAACTGAAAGGAAAGGATGAAACGGATTCTCCCACAGTGCACTTGGGCT

TGGATTCGGACTCGGAGAGCGAACTTGTCATAGACTTAGGAGAGGATCCTTCTGGGAGGGAGGGTCGAAAAAACAAGAAAGATCCCAAGGTGCCGTCGCC

TAAGCAAGACG - UNI113 - - UNI238 - - UNI14944 - - UNI15535 - - UNI15537 - - UNI21114 - - UNI31684 - C

TATAGGTAAACCGCCACCGTCGTCCACTTCGGCGGGCAACCAGTCTCCCCCAGAGACACCGGTACTCACCCGCTCAGCCACCCAAGCACCCGCGGCTGGG

GTCACCGTGGCCGCCGCCACCACCAGCACGATGTCTACCGTCACAGTCACGGCACCGGCCACCGCCGTCACGGGAAGCCCGGTGAAGAAGCAGAGGCCGC

TCTTACCGAAGGAGACTGTCCCAGCTGTGCAGCGGGTCGTGTGGAACGCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAAGATACA

GCGCCAGCAGCAGCAGCAGCAACAACAACAGCAGAGCCAACAGCAGAGCCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACCAGACAG

GCTGTGAAAG - UNI238 - - UNI7428 - - UNI15535 - - UNI15537 - - UNI21114 - - UNI32699 - CTGTCCAGCAGAAG

GAGGTCACCCAGAGCCCATCCACGTCCACCATCACGCTGGTGACCAGCACACAGCCGGCAGCCCTGGTCAGCAGTTCGGGCTCAGCAAGCACCCTGGCGT

CTGCAATCAATGCCGACCTTCCCATTGCCACCGCCTCGGCCGACGTGGCCGCAGACATTGCCAAGTACACCAGCAAA - UNI7428 - - UNI15537

 - - UNI32699 - ATGATGGATGCCATAAAGGGGACGATGACAGAAATCTACAATGACCTCTCCAAGAACACCACTGGGAGCACAATAGCTGAG - 

UNI28133 - - UNI32699 - ATTCGAAGGCTGAGGATTGAGATTGAGAAACTGCAGTGGCTGCACCAGCAGGAGCTCGCTGAGATGAAGCACAACC

TGG - UNI28132 - AGTTGACCATGGCCGAGATGCGGCAGAGCCTGGAACAGGAGCGGGATCGGCTCATTGCCGAGGTGAAAAAGCAACTGGAGCTG

GAGAAGCAGCAGGCGGTGGACGAGACCAAGAAGAAGCAGTGGTGTGCCAACTGCAAGAAGGAGGCCATTTTCTACTGCTGCTGGAACACCAGCTACTGTG

ACTACCCCTGTCAGCAGGCCCACTGGCCCGAGCACATGAAGTCCTGTACCCAGTCGG - UNI12375 - - UNI18789 - - UNI21885 - CGA

CTGCCCCTCAGCAGGAAGCAGATGCCGAGGCAAGCACAGAAACAGGAAATAAGTCATCGCAGGGCAACTCCTCCAACACACAGTCAGCACCTTCAGAACC

GGCCAGCGCCCCCAAAGAGAAAGAGGCGCCAGCGGAGAAGAGCAAGGACAGTAGTAACTCG - UNI21885 - ACCCTGGATCTTTCCGGCTCCAGAG

AGACGCCCTCCTCTATGCTCTTAGGCTCCAATCAAAGCTCTG - UNI729 - TTAGCAAGAGGTGTGACAAGCAGCCTGCCTATACCCCAACCACTAC

AGACCACCAGCCGCACCCCAACTACCCAGCCCAGAAGT ACCATTCCCGGAGCAGCAAGGCAGGTTTGTGGAGCAGCAGCGAGGAGAAGCGAGCGTCATC

CCGCTCTGAGCACAGTGGAGGGACCAGCACGAAGAACCTCATGCCCAAAGAGTCCCGGGAGTCTCGGCTAGATGCCTTCTGGGACTAGGGGTGCATTGTG

AGCCAGAACACCTCCCTATAGGCGGGAGAAACAGCCCAAACCACAGGAAGCAACAGAAACTGGAGAACCGCCACCTTTAGAATTTCCAACACTCAGGCTC

TGCCCGTCGGCTTGGCTGCAGGACAGAGACTTGACTCCATCCCAGCTCTGGTCTTGGCTGGGATGGCACTACCCTGTGAGCCAAACACTTTAGGTGTAAG

TAGGTACACTTGTGACGTCACTGACCTAGCGTACCTTTCCTTTTCATATCTACACTGACCTTAACTTATAAAAAAAACAGAAAAGAAAAGCAAGTTTTAT

ATATATACATATATATATAAAGATCTACAATTAAAAGAATGTTTTGATAATCCAGGGGCTGGTTAGTGAGCCCGCTGGCCTCACTGGGGTGTCAGGGCTG

GGCCCAGGGATTGCTATTTTCACGTAGGCCCTTGTCCTTGGATACCCAGGGGAGGGAGCCACTGTCGCCGCAGCACACCAGGATTGGGGCTCTCAGGCTG

TGCTGCCCTAGACCCGCCACACCAAGCCATCCGCCCCTCACAGACCCTACAAGACGATGTTAGGAAACACATGCTTGCTGGCCTTGAAGGACACAGAGAG

AAGTATGTGTGTGTGGTGTGTTTCCAGCTCTGGCTCCCGAAGGGGCAAAGCAGCCTCCTGTTTACAGAAGGTCCACGCGAGCTATCCCCGTGGCGTTACG

AATGCAGCCAGCGCCCGGCGTTTGTGCAGGGGTGTCGGGAACGAACGCAGCCAGCGGGCATCTGTGCGTGCGAGGAGACCCCTTCTCTCGGCCAAGTTTT

TTCCCATAACACCCACATGGATTTGTGAAGACGTGCTTCTCAGAAGCAAGGACTCAAAAAGCAAAGGTGCACGGCGAGGCCACGAAGCCCACGCCAGCCC

GGGGATGGAGCATGTATGTATTATTTATCTGCTGGAGTTCTACGTTTTTATGTAAGCATGAAACACAGGCAGTGTGAGAGAAAGCCAGGACCCGACATGC

TGTCCGTTAACGCTACGTCTGCTGTAGTTCCATTTTGTATGTTGTGTAAAGCGAGCATCGATCGAAGCAAAAGGTGATGTGTGTATATCAGAAAAAAGAA

ATTAACTGTATATCATTCCAGTACATTCCGTTGTACATTTTAGTCTCCGTTTACTTTCTCTTCATTGTTGATAAGAGAATGCCAAGCTGCGCGTTGTTCA

GGCAGTTTACCCCTACTAGAGAAGAAAGGAAGAAACGCTAGAAGAAAACAGGAGAGAGAGAAAATTTGTGAATTGCGGTCGTCAAAACAAAACAAAACAA

ACAAAAAAAAACAATCTAGCCTAGCTGGCCTTATTTGGGAAGCGTAACTGCTTTTAGCATATGGGAGTATTTTTTCACATTTTCTTTGTATAAAATTTGT

ATTAAACTTAAATATCTTTTTTGA
Translation
QEPKED - UNI12811 - - UNI14301 - - UNI15045 - DPVSTEKTAPKRRFPSPPHSSNGHSPQDSSTSPIKKKKKPGLLNSSNKEQ - U

NI7754 - - UNI12811 - - UNI14301 - SELRHGPFYYMKQPLTTDPVDVVPQDGRNDFYCWVCHREGQVLCCELCPRVYHAKCLRLTSEPEG

DWFCPECE - UNI25158 - KITVAECIETQSKAMTMLTIEQLSYLLKFAIQKMKQPG - UNI24744 - TDAFQKPVPLEQHPDYAEYIFHPMDL

CTLEK NAKKKMYGCTEAFLADAKWILHNCIIYNGG GNHKLTQIAKVVIKICEHE MNEIEVCPECYLAACQKRDNWFCEPC - UNI3669 - - UN

I29610 - SNPHPLVWAKLKGFPFWPAKALRDKDGQVDARFFGQHDR - UNI5045 - - UNI12805 - - UNI29610 - - UNI33792 - 

RAWVPVNNCYLMSKEIPFSVKKTKSIFNSAMQEMEVYVENIRRKFGVFNYSPFRTPYTPNNQYQMLLDPSNPSAGTAKTDKQEKVKLNFDMTASPKILLS

KPLLSGGAGRRISLSDMPRSPTSTNSSVHTGSDVEQDPEKKAPSSHFSASEESMDFLDKSTA - UNI5045 - - UNI6317 - - UNI29610 - 

- UNI33792 - - UNI36697 - ASPASTKTGQAGSLSGSPKPFSPQAPTPIMTKPDKTSTSTTGSILNLNLD - UNI144 - - UNI6317 - 

- UNI31684 - - UNI33792 - - UNI36697 - DRSKAEMDLKELSESVQQQSAPVPLISPKRQIRSRFQLNLDKTIESCKAQLG - UNI113

 - - UNI144 - - UNI14944 - - UNI15535 - - UNI31684 - - UNI36697 - GINEISEDVYTAVEHSDSEDSEKSESSDSEYVSD

EEQKPKNEPEDPEDKEGSRVDKEAPAIKRKPKPTNQVEVKEEAKSNSPVSEKPDPTPAKDKASPEPEKDFVEKAKPSPHPTKDKLKGKDETDSPTVHLGL

DSDSESELVIDLGEDPSGREGRKNKKDPKVPSPKQDA - UNI113 - - UNI238 - - UNI14944 - - UNI15535 - - UNI15537 - -

 UNI21114 - - UNI31684 - AIGKPPPSSTSAGNQSPPETPVLTRSATQAPAAGVTVAAATTSTMSTVTVTAPATAVTGSPVKKQRPLLPKETVP

AVQRVVWNASSKFQTSSQKWHMQKIQRQQQQQQQQQQSQQQSQQQQPQSSQGTRYQTRQAVKA - UNI238 - - UNI7428 - - UNI15535 - 

- UNI15537 - - UNI21114 - - UNI32699 - AVQQKEVTQSPSTSTITLVTSTQPAALVSSSGSASTLASAINADLPIATASADVAADIAKY

TSK - UNI7428 - - UNI15537 - - UNI32699 - MMDAIKGTMTEIYNDLSKNTTGSTIAE - UNI28133 - - UNI32699 - IRRL

RIEIEKLQWLHQQELAEMKHNLE - UNI28132 - ELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYCDY

PCQQAHWPEHMKSCTQSA - UNI12375 - - UNI18789 - - UNI21885 - ATAPQQEADAEASTETGNKSSQGNSSNTQSAPSEPASAPKEK

EAPAEKSKDSSNS - UNI21885 - TLDLSGSRETPSSMLLGSNQSSV - UNI729 - VSKRCDKQPAYTPTTTDHQPHPNYPAQKY YHSRSSKA

GLWSSSEEKRASSRSEHSGGTSTKNLMPKESRESRLDAFWD
Transcript ENSMUST00000088113
Sequence
GAAGGCCTAGCTTAGCCTGTCTTTTTCTATGCACAGGATGGCTCTTGCTCACCCGAGCCTCACAAAGATAATCGCTCAGGAAGTGTTTCAGCCAATCGGC

GGCGGCTTTACACTCCGATTGGCCGGGGCAGCCAATCGGGGATGAGCTTTTATTAGGCGGCCAGATCATCAGCCGAAGTGCCAAACCCTTTTTCTGTGAG

AACTAGGAGCCTGTCCTCCATGTTTTATAAGTATTGACATTACACAGTTAACAATGCATCCACAGAG - UNI3682 - - UNI12801 - - UNI15

045 - - UNI15618 - - UNI15763 - - UNI29489 - - UNI29535 - - UNI29769 - - UNI30294 - CTTGGCTGAAGAGGAA

ATAAAAACCGAGCAGGAGGTGGTGGAGGGAATGGATATCTCTACTCGCTCCAAAG - UNI5223 - - UNI12801 - - UNI12811 - - UNI1

4301 - - UNI15045 - - UNI15763 - ATCCTGTCTCTACAGAGAAAACGGCCCCGAAACGGAGGTTCCCCAGCCCTCCACATTCCTCCAATGG

CCATTCGCCCCAAGACTCATCCACGAGCCCCATTAAAAAGAAAAAGAAACCCGGCTTACTCAACAGTAGCAATAAGGAACAG - UNI7754 - - UNI

12811 - - UNI14301 - - UNI25158 - GACGGACGGAATGACTTCTATTGCTGGGTTTGTCACCGGGAAGGACAAGTCCTTTGCTGTGAGCTC

TGTCCCCGGGTTTATCACGCTAAGTGTCTGAGACTGACATCGGAGCCAGAGGGGGACTGGTTTTGTCCTGAATGTGAG - UNI25158 - AAGATTAC

AGTAGCAGAATGCATCGAGACGCAGAGCAAAGCCATGACCATGCTGACCATTGAACAACTGTCCTACCTGCTCAAGTTTGCCATTCAGAAAATGAAGCAG

CCAGGG - UNI24744 - ACGGATGCATTCCAGAAGCCTGTTCCATTGGAGCAACACCCTGACTATGCAGAATATATTTTCCACCCCATGGACCTTTG

TACATTGGAAAAG AATGCAAAAAAGAAGATGTACGGCTGCACAGAAGCCTTCCTGGCCGATGCCAAGTGGATCCTGCACAACTGCATTATTTATAATGG

GG GAAATCACAAGTTGACGCAAATAGCAAAAGTCGTCATCAAAATCTGTGAGCACGAG ATGAATGAAATCGAAGTCTGTCCAGAATGTTATCTTGCAG

CTTGCCAAAAACGAGACAACTGGTTCTGTGAGCCCTGT - UNI3669 - - UNI29610 - AGCAATCCGCACCCTTTGGTCTGGGCAAAACTGAAA

GGATTTCCATTCTGGCCAGCGAAAGCTCTGAGGGACAAAGACGGGCAGGTTGACGCCCGTTTCTTTGGACAACATGACAG - UNI5045 - - UNI12

805 - - UNI29610 - - UNI33792 - AGCCTGGGTTCCAGTCAATAATTGCTACCTCATGTCTAAAGAAATCCCCTTTTCTGTGAAAAAGACTA

AAAGTATCTTCAACAGCGCCATGCAAGAGATGGAAGTTTACGTGGAGAACATACGGAGGAAGTTTGGGGTTTTTAATTACTCCCCGTTCAGGACGCCCTA

CACGCCCAACAACCAGTACCAAATGCTGCTGGATCCCAGCAACCCCAGCGCGGGCACAGCCAAGACAGACAAACAGGAGAAGGTGAAGCTTAATTTTGAC

ATGACAGCGTCCCCCAAGATCCTTCTGAGCAAGCCCCTTCTGAGCGGGGGTGCCGGCCGCAGGATCTCCCTGTCCGACATGCCTCGCTCCCCCACCAGTA

CGAACTCTTCCGTGCACACGGGCTCCGATGTGGAGCAGGACCCCGAGAAGAAGGCCCCGTCCAGCCACTTCAGCGCAAGCGAGGAGTCCATGGACTTCCT

TGATAAGAGCACAG - UNI5045 - - UNI6317 - - UNI29610 - - UNI33792 - - UNI36697 - CTTCTCCAGCCTCCACCAAGAC

GGGGCAAGCCGGGAGCTTGTCTGGCAGCCCAAAGCCTTTCTCTCCGCAAGCGCCGACACCCATCATGACAAAACCCGACAAGACTTCCACCTCCACCACC

GGGAGCATCCTGAACCTGAACTTGG - UNI144 - - UNI6317 - - UNI31684 - - UNI33792 - - UNI36697 - ATCGAAGCAAGG

CCGAGATGGACCTGAAGGAGCTGAGCGAGTCGGTCCAGCAGCAGTCAGCCCCCGTCCCTCTCATCTCTCCCAAGCGGCAGATTCGAAGCCGGTTCCAGCT

CAACCTGGACAAGACCATAGAGAGTTGCAAAGCACAGCTAG - UNI113 - - UNI144 - - UNI14944 - - UNI15535 - - UNI31684

 - - UNI36697 - GCATAAATGAGATCTCAGAGGATGTTTATACAGCCGTGGAGCACAGCGATTCCGAGGACTCCGAAAAGTCGGAGAGCAGCGACA

GCGAGTACGTCAGCGATGAGGAACAGAAGCCCAAGAATGAGCCCGAGGACCCCGAGGACAAAGAGGGGAGTCGGGTGGACAAAGAGGCCCCTGCCATCAA

AAGGAAGCCCAAACCCACAAACCAGGTAGAGGTCAAAGAGGAAGCGAAGAGCAACTCTCCTGTCAGCGAGAAGCCGGACCCCACACCCGCCAAGGACAAG

GCCAGCCCAGAGCCTGAGAAGGACTTTGTAGAGAAAGCAAAGCCATCACCTCATCCCACAAAGGACAAACTGAAAGGAAAGGATGAAACGGATTCTCCCA

CAGTGCACTTGGGCTTGGATTCGGACTCGGAGAGCGAACTTGTCATAGACTTAGGAGAGGATCCTTCTGGGAGGGAGGGTCGAAAAAACAAGAAAGATCC

CAAGGTGCCGTCGCCTAAGCAAGACG - UNI113 - - UNI238 - - UNI14944 - - UNI15535 - - UNI15537 - - UNI21114 -

 - UNI31684 - CTATAGGTAAACCGCCACCGTCGTCCACTTCGGCGGGCAACCAGTCTCCCCCAGAGACACCGGTACTCACCCGCTCAGCCACCCAA

GCACCCGCGGCTGGGGTCACCGTGGCCGCCGCCACCACCAGCACGATGTCTACCGTCACAGTCACGGCACCGGCCACCGCCGTCACGGGAAGCCCGGTGA

AGAAGCAGAGGCCGCTCTTACCGAAGGAGACTGTCCCAGCTGTGCAGCGGGTCGTGTGGAACGCATCAA - UNI238 - - UNI7428 - - UNI14

944 - - UNI15535 - - UNI15537 - - UNI21114 - - UNI32699 - CTGTCCAGCAGAAGGAGGTCACCCAGAGCCCATCCACGTCCA

CCATCACGCTGGTGACCAGCACACAGCCGGCAGCCCTGGTCAGCAGTTCGGGCTCAGCAAGCACCCTGGCGTCTGCAATCAATGCCGACCTTCCCATTGC

CACCGCCTCGGCCGACGTGGCCGCAGACATTGCCAAGTACACCAGCAAA - UNI7428 - - UNI15537 - - UNI32699 - ATGATGGATGCC

ATAAAGGGGACGATGACAGAAATCTACAATGACCTCTCCAAGAACACCACTGGGAGCACAATAGCTGAG - UNI28133 - - UNI32699 - ATTC

GAAGGCTGAGGATTGAGATTGAGAAACTGCAGTGGCTGCACCAGCAGGAGCTCGCTGAGATGAAGCACAACCTGG - UNI28132 - AGTTGACCATG

GCCGAGATGCGGCAGAGCCTGGAACAGGAGCGGGATCGGCTCATTGCCGAGGTGAAAAAGCAACTGGAGCTGGAGAAGCAGCAGGCGGTGGACGAGACCA

AGAAGAAGCAGTGGTGTGCCAACTGCAAGAAGGAGGCCATTTTCTACTGCTGCTGGAACACCAGCTACTGTGACTACCCCTGTCAGCAGGCCCACTGGCC

CGAGCACATGAAGTCCTGTACCCAGTCGG - UNI12375 - - UNI18789 - - UNI21885 - CGACTGCCCCTCAGCAGGAAGCAGATGCCGA

GGCAAGCACAGAAACAGGAAATAAGTCATCGCAGGGCAACTCCTCCAACACACAGTCAGCACCTTCAGAACCGGCCAGCGCCCCCAAAGAGAAAGAGGCG

CCAGCGGAGAAGAGCAAGGACAGTA - UNI12375 - - UNI21885 - ACCCTGGATCTTTCCGGCTCCAGAGAGACGCCCTCCTCTATGCTCTTA

GGCTCCAATCAAAGCTCTG - UNI729 - ACCATTCCCGGAGCAGCAAGGCAGGTTTGTGGAGCAGCAGCGAGGAGAAGCGAGCGTCATCCCGCTCTG

AGCACAGTGGAGGGACCAGCACGAAGAACCTCATGCCCAAAGAGTCCCGGGAGTCTCGGCTAGATGCCTTCTGGGACTAGGGGTGCATTGTGAGCCAGAA

CACCTCCCTATAGGCGGGAGAAACAGCCCAAACCACAGGAAGCAACAGAAA
Translation
MHPQS - UNI3682 - - UNI12801 - - UNI15045 - - UNI15618 - - UNI15763 - - UNI29489 - - UNI29535 - - UN

I29769 - - UNI30294 - SLAEEEIKTEQEVVEGMDISTRSKD - UNI5223 - - UNI12801 - - UNI12811 - - UNI14301 - -

 UNI15045 - - UNI15763 - DPVSTEKTAPKRRFPSPPHSSNGHSPQDSSTSPIKKKKKPGLLNSSNKEQ - UNI7754 - - UNI12811 -

 - UNI14301 - - UNI25158 - DGRNDFYCWVCHREGQVLCCELCPRVYHAKCLRLTSEPEGDWFCPECE - UNI25158 - KITVAECIETQ

SKAMTMLTIEQLSYLLKFAIQKMKQPG - UNI24744 - TDAFQKPVPLEQHPDYAEYIFHPMDLCTLEK NAKKKMYGCTEAFLADAKWILHNCIIY

NGG GNHKLTQIAKVVIKICEHE MNEIEVCPECYLAACQKRDNWFCEPC - UNI3669 - - UNI29610 - SNPHPLVWAKLKGFPFWPAKALRD

KDGQVDARFFGQHDR - UNI5045 - - UNI12805 - - UNI29610 - - UNI33792 - RAWVPVNNCYLMSKEIPFSVKKTKSIFNSAMQE

MEVYVENIRRKFGVFNYSPFRTPYTPNNQYQMLLDPSNPSAGTAKTDKQEKVKLNFDMTASPKILLSKPLLSGGAGRRISLSDMPRSPTSTNSSVHTGSD

VEQDPEKKAPSSHFSASEESMDFLDKSTA - UNI5045 - - UNI6317 - - UNI29610 - - UNI33792 - - UNI36697 - ASPASTK

TGQAGSLSGSPKPFSPQAPTPIMTKPDKTSTSTTGSILNLNLD - UNI144 - - UNI6317 - - UNI31684 - - UNI33792 - - UNI36

697 - DRSKAEMDLKELSESVQQQSAPVPLISPKRQIRSRFQLNLDKTIESCKAQLG - UNI113 - - UNI144 - - UNI14944 - - UNI1

5535 - - UNI31684 - - UNI36697 - GINEISEDVYTAVEHSDSEDSEKSESSDSEYVSDEEQKPKNEPEDPEDKEGSRVDKEAPAIKRKPKP

TNQVEVKEEAKSNSPVSEKPDPTPAKDKASPEPEKDFVEKAKPSPHPTKDKLKGKDETDSPTVHLGLDSDSESELVIDLGEDPSGREGRKNKKDPKVPSP

KQDA - UNI113 - - UNI238 - - UNI14944 - - UNI15535 - - UNI15537 - - UNI21114 - - UNI31684 - AIGKPPPS

STSAGNQSPPETPVLTRSATQAPAAGVTVAAATTSTMSTVTVTAPATAVTGSPVKKQRPLLPKETVPAVQRVVWNAST - UNI238 - - UNI7428 

- - UNI14944 - - UNI15535 - - UNI15537 - - UNI21114 - - UNI32699 - TVQQKEVTQSPSTSTITLVTSTQPAALVSSSGS

ASTLASAINADLPIATASADVAADIAKYTSK - UNI7428 - - UNI15537 - - UNI32699 - MMDAIKGTMTEIYNDLSKNTTGSTIAE - 

UNI28133 - - UNI32699 - IRRLRIEIEKLQWLHQQELAEMKHNLE - UNI28132 - ELTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVD

ETKKKQWCANCKKEAIFYCCWNTSYCDYPCQQAHWPEHMKSCTQSA - UNI12375 - - UNI18789 - - UNI21885 - ATAPQQEADAEAST

ETGNKSSQGNSSNTQSAPSEPASAPKEKEAPAEKSKDSN - UNI12375 - - UNI21885 - NPGSFRLQRDALLYALRLQSKL - UNI729 - 

L
Transcript ENSMUST00000109262
Sequence
CAAAGTCCTTGCTTTTGTATAGATTCAAAGTAAGTGCGGAGAGAATGCTGGGTTCTGGAGGTAAATGAGTTGTCTCAGGAAGCCGGAACCCAAGTCAT -

 UNI3682 - - UNI12801 - - UNI15045 - - UNI15618 - - UNI15763 - - UNI29489 - - UNI29535 - - UNI29769 

- - UNI30294 - CTTGGCTGAAGAGGAAATAAAAACCGAGCAGGAGGTGGTGGAGGGAATGGATATCTCTACTCGCTCCAAAG - UNI5223 - -

 UNI12801 - - UNI12811 - - UNI14301 - - UNI15045 - - UNI15763 - ATCCTGTCTCTACAGAGAAAACGGCCCCGAAACGGA

GGTTCCCCAGCCCTCCACATTCCTCCAATGGCCATTCGCCCCAAGACTCATCCACGAGCCCCATTAAAAAGAAAAAGAAACCCGGCTTACTCAACAGTAG

CAATAAGGAACAG - UNI7754 - - UNI12811 - - UNI14301 - - UNI25158 - GACGGACGGAATGACTTCTATTGCTGGGTTTGTCA

CCGGGAAGGACAAGTCCTTTGCTGTGAGCTCTGTCCCCGGGTTTATCACGCTAAGTGTCTGAGACTGACATCGGAGCCAGAGGGGGACTGGTTTTGTCCT

GAATGTGAG - UNI25158 - AAGATTACAGTAGCAGAATGCATCGAGACGCAGAGCAAAGCCATGACCATGCTGACCATTGAACAACTGTCCTACCT

GCTCAAGTTTGCCATTCAGAAAATGAAGCAGCCAGGG - UNI24744 - ACGGATGCATTCCAGAAGCCTGTTCCATTGGAGCAACACCCTGACTATG

CAGAATATATTTTCCACCCCATGGACCTTTGTACATTGGAAAAG AATGCAAAAAAGAAGATGTACGGCTGCACAGAAGCCTTCCTGGCCGATGCCAAGT

GGATCCTGCACAACTGCATTATTTATAATGGGG GAAATCACAAGTTGACGCAAATAGCAAAAGTCGTCATCAAAATCTGTGAGCACGAG ATGAATGAA

ATCGAAGTCTGTCCAGAATGTTATCTTGCAGCTTGCCAAAAACGAGACAACTGGTTCTGTGAGCCCTGT - UNI3669 - - UNI29610 - AGCAA

TCCGCACCCTTTGGTCTGGGCAAAACTGAAAGGATTTCCATTCTGGCCAGCGAAAGCTCTGAGGGACAAAGACGGGCAGGTTGACGCCCGTTTCTTTGGA

CAACATGACAG - UNI5045 - - UNI12805 - - UNI29610 - - UNI33792 - AGCCTGGGTTCCAGTCAATAATTGCTACCTCATGTCT

AAAGAAATCCCCTTTTCTGTGAAAAAGACTAAAAGTATCTTCAACAGCGCCATGCAAGAGATGGAAGTTTACGTGGAGAACATACGGAGGAAGTTTGGGG

TTTTTAATTACTCCCCGTTCAGGACGCCCTACACGCCCAACAACCAGTACCAAATGCTGCTGGATCCCAGCAACCCCAGCGCGGGCACAGCCAAGACAGA

CAAACAGGAGAAGGTGAAGCTTAATTTTGACATGACAGCGTCCCCCAAGATCCTTCTGAGCAAGCCCCTTCTGAGCGGGGGTGCCGGCCGCAGGATCTCC

CTGTCCGACATGCCTCGCTCCCCCACCAGTACGAACTCTTCCGTGCACACGGGCTCCGATGTGGAGCAGGACCCCGAGAAGAAGGCCCCGTCCAGCCACT

TCAGCGCAAGCGAGGAGTCCATGGACTTCCTTGATAAGAGCACAGGTCAGCCCCAGTTGGGAGAGTTGGGTAGGAGGCCACTTGGTGCATTCTGGCGTCC

CTGGATGCCTCCCTCATAGGTGCGAGCCGGCAGGCACCACCAGATCCCACAGATGAGGGAGATAGTCCCCAAGGAAGGCCAGGTGGGGCCATTCTTAGAA

GCGGATGGCAATGGCCGGCCACAAACCCTGCAGGGCTCGAGGCCACTGTCAGAGCCTCATGGCTGTTCGCAGCAGTGCCCTTGACTCTTTTCTTCTCATC

ACGGTGTAGTTGAAAGCTTAGTTTTTTTTTTTTTTTTTTTTTTTTTAAAGATTTATTTATTATTATATGTAAGTACACTGTAGCTGTCTTCAGACACACC

AGAAGAGGGAGTCAGATCTTGTTACGGATGGTTGTGAGCCACCATGTGGTTGCTGGGATTTGAACTCTGGACCTTCGGAAGAGCAGTCGGGTGCTCTTAC

CCACTGAGCCATCTCACCAGCCCCCGAAAGCTTAGTTTTTGATACCTTTGTGTTAGGGTTGACTTAGACGTGAGGAGACTGAGGTGAAAATTGATCCCCC

TTGCCTCCTTCAGGGCTGGCTTTTCCAGCTATGTGTCGTAGTTTGGAGACAACAACTGGTCTCTAATTGCAGGACTCCCCATCAGTTGATGTGGCTTTGG

GGACATATTTAATGTCTTTATGCCTTAGCCTTCCCACCTCTACCATGGCGACCGTAACTGGCTACGCCGAGCCTCCCCTATGTGTAAGCTCTGTTGAGAG

CACAAGGAGTCAGGACCCACAGTAGGACAGGAGCACTGGGGCAGTGTTGACCATGGAATTCTTTTTCCTGGTGATCTCTAAAGTGCTGGCTGCGAGGATC

TGAGAAGAGATGCAATGGAGGGGTGACTTAAGGAATGTTCTTGGCAGGAAGATCCTCCCATCTCCCTCTTCCACGGGCTGGGCTTACAGGTGTACCCCAC

CACAGCTGCCCCATTAAAACCTGCTTGAAGTTAGCACATCGTAAAATAAAGTGTGTTCGTGTGCAAACTCC
Translation
 - UNI3682 - - UNI12801 - - UNI15045 - - UNI15618 - - UNI15763 - - UNI29489 - - UNI29535 - - UNI2976

9 - - UNI30294 - MDISTRSKD - UNI5223 - - UNI12801 - - UNI12811 - - UNI14301 - - UNI15045 - - UNI1576

3 - DPVSTEKTAPKRRFPSPPHSSNGHSPQDSSTSPIKKKKKPGLLNSSNKEQ - UNI7754 - - UNI12811 - - UNI14301 - - UNI25

158 - DGRNDFYCWVCHREGQVLCCELCPRVYHAKCLRLTSEPEGDWFCPECE - UNI25158 - KITVAECIETQSKAMTMLTIEQLSYLLKFAIQ

KMKQPG - UNI24744 - TDAFQKPVPLEQHPDYAEYIFHPMDLCTLEK NAKKKMYGCTEAFLADAKWILHNCIIYNGG GNHKLTQIAKVVIKICE

HE MNEIEVCPECYLAACQKRDNWFCEPC - UNI3669 - - UNI29610 - SNPHPLVWAKLKGFPFWPAKALRDKDGQVDARFFGQHDR - UNI

5045 - - UNI12805 - - UNI29610 - - UNI33792 - RAWVPVNNCYLMSKEIPFSVKKTKSIFNSAMQEMEVYVENIRRKFGVFNYSPFR

TPYTPNNQYQMLLDPSNPSAGTAKTDKQEKVKLNFDMTASPKILLSKPLLSGGAGRRISLSDMPRSPTSTNSSVHTGSDVEQDPEKKAPSSHFSASEESM

DFLDKSTGQPQLGELGRRPLGAFWRPWMPPS
Transcript ENSMUST00000109258
Sequence
ATGGAGCTACGCAGTCGCAGGAGCCAGGGGTGGAAGATGTCGGGAAG - UNI549 - - UNI3682 - - UNI12801 - - UNI15045 - - U

NI15618 - - UNI15763 - - UNI29489 - - UNI29535 - - UNI29769 - - UNI30294 - CTTGGCTGAAGAGGAAATAAAAACC

GAGCAGGAGGTGGTGGAGGGAATGGATATCTCTACTCGCTCCAAAG - UNI5223 - - UNI12801 - - UNI12811 - - UNI14301 - - 

UNI15045 - - UNI15763 - ATCCTGTCTCTACAGAGAAAACGGCCCCGAAACGGAGGTTCCCCAGCCCTCCACATTCCTCCAATGGCCATTCGCC

CCAAGACTCATCCACGAGCCCCATTAAAAAGAAAAAGAAACCCGGCTTACTCAACAGTAGCAATAAGGAACAG - UNI7754 - - UNI12811 - -

 UNI14301 - - UNI25158 - GACGGACGGAATGACTTCTATTGCTGGGTTTGTCACCGGGAAGGACAAGTCCTTTGCTGTGAGCTCTGTCCCCGG

GTTTATCACGCTAAGTGTCTGAGACTGACATCGGAGCCAGAGGGGGACTGGTTTTGTCCTGAATGTGAG - UNI25158 - AAGATTACAGTAGCAGA

ATGCATCGAGACGCAGAGCAAAGCCATGACCATGCTGACCATTGAACAACTGTCCTACCTGCTCAAGTTTGCCATTCAGAAAATGAAGCAGCCAGGG - 

UNI24744 - ACGGATGCATTCCAGAAGCCTGTTCCATTGGAGCAACACCCTGACTATGCAGAATATATTTTCCACCCCATGGACCTTTGTACATTGGA

AAAG AATGCAAAAAAGAAGATGTACGGCTGCACAGAAGCCTTCCTGGCCGATGCCAAGTGGATCCTGCACAACTGCATTATTTATAATGGGG GAAATC

ACAAGTTGACGCAAATAGCAAAAGTCGTCATCAAAATCTGTGAGCACGAG ATGAATGAAATCGAAGTCTGTCCAGAATGTTATCTTGCAGCTTGCCAAA

AACGAGACAACTGGTTCTGTGAGCCCTGT - UNI3669 - - UNI29610 - AGCAATCCGCACCCTTTGGTCTGGGCAAAACTGAAAGGATTTCCA

TTCTGGCCAGCGAAAGCTCTGAGGGACAAAGACGGGCAGGTTGACGCCCGTTTCTTTGGACAACATGACAG - UNI5045 - - UNI12805 - - U

NI29610 - - UNI33792 - AGCCTGGGTTCCAGTCAATAATTGCTACCTCATGTCTAAAGAAATCCCCTTTTCTGTGAAAAAGACTAAAAGTATCT

TCAACAGCGCCATGCAAGAGATGGAAGTTTACGTGGAGAACATACGGAGGAAGTTTGGGGTTTTTAATTACTCCCCGTTCAGGACGCCCTACACGCCCAA

CAACCAGTACCAAATGCTGCTGGATCCCAGCAACCCCAGCGCGGGCACAGCCAAGACAGACAAACAGGAGAAGGTGAAGCTTAATTTTGACATGACAGCG

TCCCCCAAGATCCTTCTGAGCAAGCCCCTTCTGAGCGGGGGTGCCGGCCGCAGGATCTCCCTGTCCGACATGCCTCGCTCCCCCACCAGTACGAACTCTT

CCGTGCACACGGGCTCCGATGTGGAGCAGGACCCCGAGAAGAAGGCCCCGTCCAGCCACTTCAGCGCAAGCGAGGAGTCCATGGACTTCCTTGATAAGAG

CACAG - UNI5045 - - UNI6317 - - UNI29610 - - UNI33792 - - UNI36697 - CTTCTCCAGCCTCCACCAAGACGGGGCAAGC

CGGGAGCTTGTCTGGCAGCCCAAAGCCTTTCTCTCCGCAAGCGCCGACACCCATCATGACAAAACCCGACAAGACTTCCACCTCCACCACCGGGAGCATC

CTGAACCTGAACTTGG - UNI144 - - UNI6317 - - UNI31684 - - UNI33792 - - UNI36697 - ATCGAAGCAAGGCCGAGATGG

ACCTGAAGGAGCTGAGCGAGTCGGTCCAGCAGCAGTCAGCCCCCGTCCCTCTCATCTCTCCCAAGCGGCAGATTCGAAGCCGGTTCCAGCTCAACCTGGA

CAAGACCATAGAGAGTTGCAAAGCACAGCTAG - UNI113 - - UNI144 - - UNI14944 - - UNI15535 - - UNI31684 - - UNI3

6697 - GCATAAATGAGATCTCAGAGGATGTTTATACAGCCGTGGAGCACAGCGATTCCGAGGACTCCGAAAAGTCGGAGAGCAGCGACAGCGAGTACG

TCAGCGATGAGGAACAGAAGCCCAAGAATGAGCCCGAGGACCCCGAGGACAAAGAGGGGAGTCGGGTGGACAAAGAGGCCCCTGCCATCAAAAGGAAGCC

CAAACCCACAAACCAGGTAGAGGTCAAAGAGGAAGCGAAGAGCAACTCTCCTGTCAGCGAGAAGCCGGACCCCACACCCGCCAAGGACAAGGCCAGCCCA

GAGCCTGAGAAGGACTTTGTAGAGAAAGCAAAGCCATCACCTCATCCCACAAAGGACAAACTGAAAGGAAAGGATGAAACGGATTCTCCCACAGTGCACT

TGGGCTTGGATTCGGACTCGGAGAGCGAACTTGTCATAGACTTAGGAGAGGATCCTTCTGGGAGGGAGGGTCGAAAAAACAAGAAAGATCCCAAGGTGCC

GTCGCCTAAGCAAGACG - UNI113 - - UNI238 - - UNI14944 - - UNI15535 - - UNI15537 - - UNI21114 - - UNI316

84 - CTATAGGTAAACCGCCACCGTCGTCCACTTCGGCGGGCAACCAGTCTCCCCCAGAGACACCGGTACTCACCCGCTCAGCCACCCAAGCACCCGCG

GCTGGGGTCACCGTGGCCGCCGCCACCACCAGCACGATGTCTACCGTCACAGTCACGGCACCGGCCACCGCCGTCACGGGAAGCCCGGTGAAGAAGCAGA

GGCCGCTCTTACCGAAGGAGACTGTCCCAGCTGTGCAGCGGGTCGTGTGGAACGCATCAAGTAAGTTTCAAACGTCCTCCCAAAAGTGGCACATGCAGAA

GATACAGCGCCAGCAGCAGCAGCAGCAACAACAACAGCAGAGCCAACAGCAGAGCCAGCAGCAGCAGCCTCAGTCTTCCCAGGGGACGAGATATCAGACC

AGACAGGCTGTGAAAG - UNI238 - - UNI7428 - - UNI15535 - - UNI15537 - - UNI21114 - - UNI32699 - CTGTCCAG

CAGAAGGAGGTCACCCAGAGCCCATCCACGTCCACCATCACGCTGGTGACCAGCACACAGCCGGCAGCCCTGGTCAGCAGTTCGGGCTCAGCAAGCACCC

TGGCGTCTGCAATCAATGCCGACCTTCCCATTGCCACCGCCTCGGCCGACGTGGCCGCAGACATTGCCAAGTACACCAGCAAA - UNI7428 - - UN

I15537 - - UNI32699 - ATGATGGATGCCATAAAGGGGACGATGACAGAAATCTACAATGACCTCTCCAAGAACACCACTGGGAGCACAATAGCT

GAG - UNI28133 - - UNI32699 - ATTCGAAGGCTGAGGATTGAGATTGAGAAACTGCAGTGGCTGCACCAGCAGGAGCTCGCTGAGATGAAGC

ACAACCTGG - UNI28132 - AGTTGACCATGGCCGAGATGCGGCAGAGCCTGGAACAGGAGCGGGATCGGCTCATTGCCGAGGTGAAAAAGCAACTG

GAGCTGGAGAAGCAGCAGGCGGTGGACGAGACCAAGAAGAAGCAGTGGTGTGCCAACTGCAAGAAGGAGGCCATTTTCTACTGCTGCTGGAACACCAGCT

ACTGTGACTACCCCTGTCAGCAGGCCCACTGGCCCGAGCACATGAAGTCCTGTACCCAGTCGG - UNI12375 - - UNI18789 - - UNI21885

 - CGACTGCCCCTCAGCAGGAAGCAGATGCCGAGGCAAGCACAGAAACAGGAAATAAGTCATCGCAGGGCAACTCCTCCAACACACAGTCAGCACCTTC

AGAACCGGCCAGCGCCCCCAAAGAGAAAGAGGCGCCAGCGGAGAAGAGCAAGGACAGTAGTAACTCG - UNI21885 - ACCCTGGATCTTTCCGGCT

CCAGAGAGACGCCCTCCTCTATGCTCTTAGGCTCCAATCAAAGCTCTG - UNI729 - TTAGCAAGAGGTGTGACAAGCAGCCTGCCTATACCCCAAC

CACTACAGACCACCAGCCGCACCCCAACTACCCAGCCCAGAAGT ACCATTCCCGGAGCAGCAAGGCAGGTTTGTGGAGCAGCAGCGAGGAGAAGCGAGC

GTCATCCCGCTCTGAGCACAGTGGAGGGACCAGCACGAAGAACCTCATGCCCAAAGAGTCCCGGGAGTCTCGGCTAGATGCCTTCTGGGACTAGGGGTGC

ATTGTGAGCCAGAACACCTCCCTATAGGCGGGAGAAACAGCCCAAACCACAGGAAGCAACAGAAACTGGAGAACCGCCACCTTTAGAATTTCCAACACTC

AGGCTCTGCCCGTCGGCTTGGCTGCAGGACAGAGACTTGACTCCATCCCAGCTCTGGTCTTGGCTGGGATGGCACTACCCTGTGAGCCAAACACTTTAGG

TGTAAGTAGGTACACTTGTGACGTCACTGACCTAGCGTACCTTTCCTTTTCATATCTACACTGACCTTAACTT
Translation
MELRSRRSQGWKMSGS - UNI549 - - UNI3682 - - UNI12801 - - UNI15045 - - UNI15618 - - UNI15763 - - UNI294

89 - - UNI29535 - - UNI29769 - - UNI30294 - SLAEEEIKTEQEVVEGMDISTRSKD - UNI5223 - - UNI12801 - - UNI

12811 - - UNI14301 - - UNI15045 - - UNI15763 - DPVSTEKTAPKRRFPSPPHSSNGHSPQDSSTSPIKKKKKPGLLNSSNKEQ - 

UNI7754 - - UNI12811 - - UNI14301 - - UNI25158 - DGRNDFYCWVCHREGQVLCCELCPRVYHAKCLRLTSEPEGDWFCPECE - 

UNI25158 - KITVAECIETQSKAMTMLTIEQLSYLLKFAIQKMKQPG - UNI24744 - TDAFQKPVPLEQHPDYA    - UNI3669 - - UN

I29610 -  - UNI5045 - - UNI12805 - - UNI29610 - - UNI33792 -  - UNI5045 - - UNI6317 - - UNI29610 - -

 UNI33792 - - UNI36697 -  - UNI144 - - UNI6317 - - UNI31684 - - UNI33792 - - UNI36697 -  - UNI113 - 

- UNI144 - - UNI14944 - - UNI15535 - - UNI31684 - - UNI36697 -  - UNI113 - - UNI238 - - UNI14944 - -

 UNI15535 - - UNI15537 - - UNI21114 - - UNI31684 -  - UNI238 - - UNI7428 - - UNI15535 - - UNI15537 -

 - UNI21114 - - UNI32699 -  - UNI7428 - - UNI15537 - - UNI32699 -  - UNI28133 - - UNI32699 -  - UNI2

8132 -  - UNI12375 - - UNI18789 - - UNI21885 -  - UNI21885 -  - UNI729 -  
Transcript ENSMUST00000109257
Sequence
GTCACATGCCTGCTGGGGGAAGAAAATGGAAG - UNI3682 - - UNI12801 - - UNI15045 - - UNI15763 - - UNI29489 - - U

NI29535 - - UNI29769 - - UNI30294 - CTTGGCTGAAGAGGAAATAAAAACCGAGCAGGAGGTGGTGGAGGGAATGGATATCTCTACTCGC

TCCAAAG - UNI5223 - - UNI12801 - - UNI12811 - - UNI14301 - - UNI15045 - - UNI15763 - ATCCTGTCTCTACAG

AGAAAACGGCCCCGAAACGGAGGTTCCCCAGCCCTCCACATTCCTCCAATGGCCATTCGCCCCAAGACTCATCCACGAGCCCCATTAAAAAGAAAAAGAA

A
Translation
 - UNI3682 - - UNI12801 - - UNI15045 - - UNI15763 - - UNI29489 - - UNI29535 - - UNI29769 - - UNI3029

4 - MDISTRSKD - UNI5223 - - UNI12801 - - UNI12811 - - UNI14301 - - UNI15045 - - UNI15763 - DPVSTEKTA

PKRRFPSPPHSSNGHSPQDSSTSPIKKKKK

For any suggestions or comments, please send an email to unitrap@crg.es