Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000039697 (Ncoa7)
Chromosomal location
Chr 10: 30356342 - 30522744 (-)
Description
nuclear receptor coactivator 7 Gene [Source:MGI Symbol;Acc:MGI:2444847]
RefSeq_dna
NM_172495 
RefSeq_peptide
NP_001104737.1 NP_766083.3 
UniGene
Mm.297903 
MGI
MGI:2444847 
Uniprot/SWISSPROT
Q6DFV7 
Uniprot/SPTREMBL
A9Q6S9 Q3TM55 Q8CG81 
Human Ortholog
ENSG00000111912 (ESNA1)
Omim not available
UniTrap UNI18905
Vector Insertion
Chr 10: 30491647 - 30522634
Public Clones (sanger) IST12312H3 (tigm) IST11442C1 (tigm) IST12830C1 (tigm) IST12832B1 (tigm)
IST14951H10 (tigm) IST12564F1 (tigm) IST12127C9 (tigm) IST11190F8 (tigm)
IST11604G10 (tigm) IST10043E2 (tigm) IST11190E8 (tigm) IST10041G4 (tigm)
IST11972D2 (tigm) IST14948B10 (tigm)
Private Clones OST411723 (lexicon) OST355270 (lexicon) OST331908 (lexicon) OST190029 (lexicon)
OST68132 (lexicon) OST67436 (lexicon) OST58198 (lexicon) OST57045 (lexicon)
OST54574 (lexicon) OST35162 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14329
Vector Insertion
Chr 10: 30442451 - 30491647
Public Clones (sanger) 5SE289B01 (ggtc) E024C08 (ggtc) CMHD-GT_521E11-5S (cmhd) FHCRC-GT-S19-3C1 (fhcrc)
PST8160-NR (escells) IST13105F12 (tigm) IST10104G7 (tigm) IST11012E4 (tigm)
IST12336B9 (tigm) IST11373D11 (tigm) IST10570D6 (tigm) IST12587E5 (tigm)
IST11637B4 (tigm) IST11224D7 (tigm) IST10472H11 (tigm) IST11976G3 (tigm)
IST11403D9 (tigm) IST11705C6 (tigm) IST14268G5 (tigm) IST12928C11 (tigm)
IST12419E5 (tigm) IST12996A12 (tigm) IST11156H10 (tigm) IST11595F7 (tigm)
IST12228G6 (tigm) IST10425H11 (tigm) IST11594E7 (tigm) IST14952D12 (tigm)
IST11772B6 (tigm) IST11013F12 (tigm) IST12679B11 (tigm) IST12367F9 (tigm)
IST11461G11 (tigm) IST11068F10 (tigm) IST11679A3 (tigm) IST12034A9 (tigm)
IST11628H9 (tigm) IST12216A10 (tigm) IST10594C3 (tigm) IST11340F6 (tigm)
IST14810C5 (tigm) IST12089C11 (tigm) IST12106H6 (tigm) IST12482C5 (tigm)
IST11679A9 (tigm) IST11552G6BBF1 (tigm) IST12702H12 (tigm) IST10674E4 (tigm)
IST10103F5 (tigm) IST15055A11 (tigm) IST14813B3 (tigm) IST10067F6 (tigm)
IST11679A6 (tigm) IST11528H10 (tigm) IST12255E12 (tigm) IST10288H11 (tigm)
IST10425H12 (tigm) IST10958A2 (tigm) IST14217E6 (tigm) IST11871D7 (tigm)
IST10805D5 (tigm) IST12716C10 (tigm) IST11260E2 (tigm) IST11042E1 (tigm)
IST14785G7 (tigm) IST12342F10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36499
Vector Insertion
Chr 10: 30382099 - 30409679
Public Clones IST12463H12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36545
Vector Insertion
Chr 10: 30356341 - 30367458
Public Clones IST14130G8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 96% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000099982
Sequence
ATGAGAGGCAGAGGACTGCCCCTGGACATTCAGATTTTCTATTGTGCCAGGCCTGACCAAGAGCCTTTTGTGAAG ATCATCACAGTTGAGGAGGCAAAA

CGCAGGAAGAGCACTTGCAGCTACTACGAGGAAGAGGAAGAAGAGGAAGAGGGACTGCCTATCCTACAGCCCCACAGTGCACTCCTGGAAAACATGCACA

TCGAACAG CTGGCCCGACGACTTCCAGCCAGGGTACAAGGCTATCCATGGAGACTGGCCTACAGCACATTAGAGCATGGAACGAGCTTGAAGACTCTCT

ACAGGAAATCAGCATCTCTAGATAGTCCTGTTCTTTTGGTCATCAAAGACATGGATAACCAG ATATTTGGGGCATATGCAACTCATCCCTTCAAGTTCA

GTGACCACTATTATGGCACAGGCGAAACGTTTCTCTACACCTTTAGTCCGAATTTCAAG - UNI36545 - GGGACGATTTGGTCTGTGGCTAGATGC

TGATTTATATCATGGACGCAGCAACTCTTGCAGTACTTTTAATAATGATATCCTTTCAAAAAAAGAAGACTTCATAGTTCAGGACCTAGAGGTATGGACA

TTTGAGTGAAACTCAGGCTGCCTTAAAATAAAACATGGAAAAGACTGGGTTAGATTAGCCGTCTTACTGGAAGACGAGCCCCAGCCCTGGCTGCCTCATC

CTACAGCAATGCTTTCTTCCTGCGGTTGTCTCAGAGCATCATAGCAATGCAGACAGATTCTGGAAGGTACTGTGGAGGGCAGACACTGAAGACAGAAATC

TCAAGTCCAGGTTGTTTTAAAAAAACAAAACAAAAAGACTTTGTACCTCCACTGCTTTCAAATTCACACCATGAGAAATCAGAGTGTTTTTTGATGTATG

AGTTGAATGCAATTTTTATTTTTGGTAACTGTGAAAAAATATGATACTGTGGAAATACATACCTTCCTTGTGTATTTATCAGCATAATTTTACCAAATAT

ATACTTTTTGTTTGCCATAGAAAGCTAAATCTGATTTAGAGAAATTGAAAGGATATAGCACTTAAAGGGAATATCTGATTTTTTAAAAACTTTTATTTAT

TATTTTTAGTATATTGTCTGAAATATATTGATTTTTTTCTTTTAATGTGTCAAATCCTGAAATAAAGAAATGTATATGTTTTGTGCTATTGGGAAACAAG

GCTCTTTTGATTTGTATAGTTTTTTATTCATTTTTTGCCCTGATTATTTAGGGTAATATAATCTTTATTTATTAAGAGAGTGAGAGAGAGGGAGAGAGAG

AGAGAGAGAGAGTCAAAAAGACAGAGACAGAGTTTTCAAAAGCTCATTACCAATGTTTTTTGATCTATTATAGACCAACTTTTTATTTAGTTTTTAAGGT

AATCTTTGAAAACCCTAAGCATTTGTGTGAAGCAGAATATAGCTTCTCTCACAGTTGTAAGATGGTGTTTATTGAAATACAGATCTTTATGAACATGAAT

GTACAAGTCCTACTTCTACAGAGTGTTTGTTTCTTATGAAATTGTGTGAATTGTATATTAATAACAGTAACTAAGTTTCTTAGTTTTTTTTCTTTTTTTC

ATTCCTTTTCTTTTTTTTCTTTTACGTTGTTTCTTTCCAGGTGTTTACATTAATGGTAGCCATCTGTTTTAAAAGAGAGTATATAATTTGTGCATTTTTA

ATGTTGGATAAAAGATGCCAAGTTGGACCAACTTTCTTGGTTTCTTGAATCTTACTGGAGAAAAAACAATTCAAAGAATTACATTCATATCACAATTG
Translation
MRGRGLPLDIQIFYCARPDQEPFVK IITVEEAKRRKSTCSYYEEEEEEEEGLPILQPHSALLENMHIEQ LARRLPARVQGYPWRLAYSTLEHGTSLKT

LYRKSASLDSPVLLVIKDMDNQ IFGAYATHPFKFSDHYYGTGETFLYTFSPNFK - UNI36545 - GTIWSVARC
Transcript ENSMUST00000092610
Sequence
ATGAGAGGCAGAGGACTGCCCCTGGACATTCAGATTTTCTATTGTGCCAGGCCTGACCAAGAGCCTTTTGTGAAG ATCATCACAGTTGAGGAGGCAAAA

CGCAGGAAGAGCACTTGCAGCTACTACGAGGAAGAGGAAGAAGAGGAAGAGGGACTGCCTATCCTACAGCCCCACAGTGCACTCCTGGAAAACATGCACA

TCGAACAG CTGGCCCGACGACTTCCAGCCAGGGTACAAGGCTATCCATGGAGACTGGCCTACAGCACATTAGAGCATGGAACGAGCTTGAAGACTCTCT

ACAGGAAATCAGCATCTCTAGATAGTCCTGTTCTTTTGGTCATCAAAGACATGGATAACCAG ATATTTGGGGCATATGCAACTCATCCCTTCAAGTTCA

GTGACCACTATTATGGCACAGGCGAAACGTTTCTCTACACCTTTAGTCCGAATTTCAAG GTCTTTAAGTGGAGTGGAGAAAACTCATATTTTATCAATG

GAGACATAAGTTCTTTAGAACTTGGTGGTGGAGG - UNI36545 - GGGACGATTTGGTCTGTGGCTAGATGCTGATTTATATCATGGACGCAGCAAC

TCTTGCAGTACTTTTAATAATGATATCCTTTCAAAAAAAGAAGACTTCATAGTTCAGGACCTAGAGGTATGGACATTTGAGTGAAACTCAGGCTGCCTTA

AAATAAAACATGGAAAAGACTGGGTTAGATTAGCCGTCTTACTGGAAGACGAGCCCCAGCCCTGGCTGCCTCATCCTACAGCAATGCTTTCTTCCTGCGG

TTGTCTCAGAGCATCATAGCAATGCAGACAGATTCTGGAAGGTACTGTGGAGGGCAGACACTGAAGACAGAAATCTCAAGTCCAGGTTGTTTTAAAAAAA

CAAAACAAAAAGACTTTGTACCTCCACTGCTTTCAAATTCACACCATGAGAAATCAGAGTGTTTTTTGATGTATGAGTTGAATGCAATTTTTATTTTTGG

TAACTGTGAAAAAATATGATACTGTGGAAATACATACCTTCCTTGTGTATTTATCAGCATAATTTTACCAAATATATACTTTTTGTTTGCCATAGAAAGC

TAAATCTGATTTAGAGAAATTGAAAGGATATAGCACTTAAAGGGAATATCTGATTTTTTAAAAACTTTTATTTATTATTTTTAGTATATTGTCTGAAATA

TATTGATTTTTTTCTTTTAATGTGTCAAATCCTGAAATAAAGAAATGTATATGTTTTGTGCTATTGGGAAACAAGGCTCTTTTGATTTGTATAGTTTTTT

ATTCATTTTTTGCCCTGATTATTTAGGGTAATATAATCTTTATTTATTAAGAGAGTGAGAGAGAGGGAGAGAGAGAGAGAGAGAGAGTCAAAAAGACAGA

GACAGAGTTTTCAAAAGCTCATTACCAATGTTTTTTGATCTATTATAGACCAACTTTTTATTTAGTTTTTAAGGTAATCTTTGAAAACCCTAAGCATTTG

TGTGAAGCAGAATATAGCTTCTCTCACAGTTGTAAGATGGTGTTTATTGAAATACAGATCTTTATGAACATGAATGTACAAGTCCTACTTCTACAGAGTG

TTTGTTTCTTATGAAATTGTGTGAATTGTATATTAATAACAGTAACTAAGTTTCTTAGTTTTTTTTCTTTTTTTCATTCCTTTTCTTTTTTTTCTTTTAC

GTTGTTTCTTTCCAGGTGTTTACATTAATGGTAGCCATCTGTTTTAAAAGAGAGTATATAATTTGTGCATTTTTAATGTTGGATAAAAGATGCCAAGTTG

GACCAACTTTCTTGGTTTCTTGAATCTTACTGGAGAAAAAACAATTCAAAGAATTACATTCATATCACAATTG
Translation
MRGRGLPLDIQIFYCARPDQEPFVK IITVEEAKRRKSTCSYYEEEEEEEEGLPILQPHSALLENMHIEQ LARRLPARVQGYPWRLAYSTLEHGTSLKT

LYRKSASLDSPVLLVIKDMDNQ IFGAYATHPFKFSDHYYGTGETFLYTFSPNFK VFKWSGENSYFINGDISSLELGGGG - UNI36545 - GGRFG

LWLDADLYHGRSNSCSTFNNDILSKKEDFIVQDLEVWTFE
Transcript ENSMUST00000068567
Sequence
CCCGGAGGATGCGCTTCCCAGCGCCCAGCGGCAGAGGCCACGGCTCCCAGAAATGCGTGCTCCCGAACCACTTCGCCCAGACCCGCGGAGCCCGCGCCCC

CGCCCAGTAG - UNI14329 - - UNI18905 - GAATATGACTCACTGATTAAAGAGGACGTTTCCAAATACTTTTTCACTTTTAGCTGTGTATTA

TGGATACTAAGGAAGAGAAGAAGGAACAGAAGGAACGGAAACAGAGTTATTTTGCTAG - UNI14329 - ACTAAAAAAGAAAAAACAAGCCAAACAA

AATGCAGAGATAGTTTCAGCTGCGTCCTCGAAGAGTCGTTCCGGGAAAGATGATGCTAATTCAGACATTTTGGAACAAGACAAGTTCAACGTTACAGCAG

AGGGGGACCATAGCACTGATGACAAAAAGAAGAGAAAAAGTAACCAGTTAAAGGAAATCAGGCGCACGGAACTGAAGAGATACTACAGTGTTG - UNI1

4329 - ATGACAATCAAAACAAAACTCATGATAAAAAAGAGAAGAAGATGATGGTCCAAAAGCCACAGGGCACCATGGAATACACT GCTGGAAGCCAG

GACACCCTCAACTCTGTTGCACTGAAGTTTAACGTCACTCCCAATAAATTAGTGGAATTGAATAAACTCTTCACACACACTATTGTTCCAGGCCAG GTC

CTGTTTGTGCCAGATGCCAACATCTCTTCTAGTACCATACAGCTTTCTTCATCCACCCCTGGTGCTACTGTCTCTCCATCATCATCAGATGCAGAGTATG

ATAAGCTGCCT GATGCAGATTTAGCAAGAAAGGCCTTAAAACCCATCGAGAGGGTCTTATCATCTACTTCCGAAGAAGATGAGCCAGGTGTTGTAAAAT

TCCTCAAAATGAACTGTCGCTACTTCACTGATGGAAAG GGTGTGGTTGGGGGTGTCATGATTGTCACTCCTAACAACATCATGTTTGACCCTCATAAGT

CCGATCCCTTAGTGATTGAAAACGGTTGCGAAGAATATGGTCTCATCTGCCCCATGGAAGAGGTGGTCTCCATTGCCCTGTACAGTGACATATCCCACAT

GAAGATCAAAGACGCCTTGCCATC TGACCTACCTCGGGATCTTTGTCCTCTGTACAGGCCTGGAGAATGGGAGGACCTGGCTTCAGAGAAAGATATCAA

TCCATTCAGTAAATTCAAGTCCATCAACAAGGAAAAACGACAGCAGAATGGGGAGAGGACCCTTGCTTTAGATGCCAAATCAGTGCGCTCTCCTGAGGAG

TCAACTGAACGTACTTGCACACGCATAGAGCCCCCAGACAACTCTGAATTGTGGAAATTAAAGAATCTGCAATCTTCCAGGGGAACAACCAGTGAGTCTC

CCTCAGTGACCCAGCTCAGCATGCGTGCTGCCTTGGAACCTACAGCCAAAGAAAACTGTCTTTTAAAAGGAGATGAGGACTTTGTTGACTTGGAAGAACT

TTCTTCTCAACCTGAGAGTGGAATCAACAAAGGAGATGCCACGAAAGAATGTCTTTCCTATGACCAAAAGAAGGATGGGCCGCATACAGTCATGTCTGCA

AAGAAGGGGCACGTGCAGTCAGCCCAGGAAGTTATGGGACCAGAGAGTGATACTGAACTGAAGGGAGCCCTAGATCTAGAAACTGCTGAGAAGCAAGATG

AAGCCCCAGAAGTAGACAAACACTCTGGATCCCCAGAAAACTTGGGGGAAAGCACGCTGAATATACACGAAGATCTAGATAAAATTAAACTCATTGAATT

TTACCTAAATAAAAACAAGGAAGGGTCACAGCTGTTAGAAAATGTGCAGAAGTCAGAGTTAAGTGACCGCAAAAGTATTGAACCAGGAGGAATAGACATC

ACACTTAGTAGCTCTCTTCCCCAAGCAGGTGATTCCCCACCTGAGGACAACAAAGAGCCAGGTACACTCTGGGTAAAAGGGGGAGAAACTCTGCCCCTGA

AACTAGATCCTAGTGCAGAGGAAACTGTAATTAACAATAAAGAGGTTCTGGATTCTTTGGGATCATCTCTAGACAAGATGTGTCACAGTGCACAGATGGA

TAACAAATCTGAGATTCAGTTATGGCTGTTAAAGAGAATTCAGGTACCAATTGAAG - UNI36499 - ATATACTTCCCTCAAAAGAAGAGAAGAGTA

AGACCCCGCCCATGTTTCTGTGCATCAAAGTGGGAAAGCCAATGAGAAAATCCTTTGCCAGTCACACCGCCACCATGGTTCAGCAGTATAGCAAGAGAAG

AAAGCAGCCTGAATACTGGTTTGCTGTTCCCCGGGAGAG - UNI36499 - GGTGGATCACTTGTACACCTTCTTTGTTCAGTGGTCTCCTGATGTCT

ATGGGAAAGATGCCAAGGAGCAAGGCTTTGTGGTGGTGGAGAAGGAAGAGCTGAACATGATCGACAATTTCTTCAGTGAGCCGACCACCAAGAGCTGGGA

G - UNI36499 - ATCATCACAGTTGAGGAGGCAAAACGCAGGAAGAGCACTTGCAGCTACTACGAGGAAGAGGAAGAAGAGGAAGAGGGACTGCCTA

TCCTACAGCCCCACAGTGCACTCCTGGAAAACATGCACATCGAACAG CTGGCCCGACGACTTCCAGCCAGGGTACAAGGCTATCCATGGAGACTGGCCT

ACAGCACATTAGAGCATGGAACGAGCTTGAAGACTCTCTACAGGAAATCAGCATCTCTAGATAGTCCTGTTCTTTTGGTCATCAAAGACATGGATAACCA

G ATATTTGGGGCATATGCAACTCATCCCTTCAAGTTCAGTGACCACTATTATGGCACAGGCGAAACGTTTCTCTACACCTTTAGTCCGAATTTCAAG G

TCTTTAAGTGGAGTGGAGAAAACTCATATTTTATCAATGGAGACATAAGTTCTTTAGAACTTGGTGGTGGAGG - UNI36545 - GGGACGATTTGGT

CTGTGGCTAGATGCTGATTTATATCATGGACGCAGCAACTCTTGCAGTACTTTTAATAATGATATCCTTTCAAAAAAAGAAGACTTCATAGTTCAGGACC

TAGAGGTATGGACATTTGAGTGAAACTCAGGCTGCCTTAAAATAAAACATGGAAAAGACTGGGTTAGATTAGCCGTCTTACTGGAAGACGAGCCCCAGCC

CTGGCTGCCTCATCCTACAGCAATGCTTTCTTCCTGCGGTTGTCTCAGAGCATCATAGCAATGCAGACAGATTCTGGAAGGTACTGTGGAGGGCAGACAC

TGAAGACAGAAATCTCAAGTCCAGGTTGTTTTAAAAAAACAAAACAAAAAGACTTTGTACCTCCACTGCTTTCAAATTCACACCATGAGAAATCAGAGTG

TTTTTTGATGTATGAGTTGAATGCAATTTTTATTTTTGGTAACTGTGAAAAAATATGATACTGTGGAAATACATACCTTCCTTGTGTATTTATCAGCATA

ATTTTACCAAATATATACTTTTTGTTTGCCATAGAAAGCTAAATCTGATTTAGAGAAATTGAAAGGATATAGCACTTAAAGGGAATATCTGATTTTTTAA

AAACTTTTATTTATTATTTTTAGTATATTGTCTGAAATATATTGATTTTTTTCTTTTAATGTGTCAAATCCTGAAATAAAGAAATGTATATGTTTTGTGC

TATTGGGAAACAAGGCTCTTTTGATTTGTATAGTTTTTTATTCATTTTTTGCCCTGATTATTTAGGGTAATATAATCTTTATTTATTAAGAGAGTGAGAG

AGAGGGAGAGAGAGAGAGAGAGAGAGTCAAAAAGACAGAGACAGAGTTTTCAAAAGCTCATTACCAATGTTTTTTGATCTATTATAGACCAACTTTTTAT

TTAGTTTTTAAGGTAATCTTTGAAAACCCTAAGCATTTGTGTGAAGCAGAATATAGCTTCTCTCACAGTTGTAAGATGGTGTTTATTGAAATACAGATCT

TTATGAACATGAATGTACAAGTCCTACTTCTACAGAGTGTTTGTTTCTTATGAAATTGTGTGAATTGTATATTAATAACAGTAACTAAGTTTCTTAGTTT

TTTTTCTTTTTTTCATTCCTTTTCTTTTTTTTCTTTTACGTTGTTTCTTTCCAGGTGTTTACATTAATGGTAGCCATCTGTTTTAAAAGAGAGTATATAA

TTTGTGCATTTTTAATGTTGGATAAAAGATGCCAAGTTGGACCAACTTTCTTGGTTTCTTGAATCTTACTGGAGAAAAAACAATTCAAAGAATTACATTC

ATATCACAATTG
Translation
 - UNI14329 - - UNI18905 - MDTKEEKKEQKERKQSYFAR - UNI14329 - RLKKKKQAKQNAEIVSAASSKSRSGKDDANSDILEQDKF

NVTAEGDHSTDDKKKRKSNQLKEIRRTELKRYYSVD - UNI14329 - DDNQNKTHDKKEKKMMVQKPQGTMEYT AGSQDTLNSVALKFNVTPNKLV

ELNKLFTHTIVPGQ VLFVPDANISSSTIQLSSSTPGATVSPSSSDAEYDKLP DADLARKALKPIERVLSSTSEEDEPGVVKFLKMNCRYFTDGK GVV

GGVMIVTPNNIMFDPHKSDPLVIENGCEEYGLICPMEEVVSIALYSDISHMKIKDALPS SDLPRDLCPLYRPGEWEDLASEKDINPFSKFKSINKEKRQ

QNGERTLALDAKSVRSPEESTERTCTRIEPPDNSELWKLKNLQSSRGTTSESPSVTQLSMRAALEPTAKENCLLKGDEDFVDLEELSSQPESGINKGDAT

KECLSYDQKKDGPHTVMSAKKGHVQSAQEVMGPESDTELKGALDLETAEKQDEAPEVDKHSGSPENLGESTLNIHEDLDKIKLIEFYLNKNKEGSQLLEN

VQKSELSDRKSIEPGGIDITLSSSLPQAGDSPPEDNKEPGTLWVKGGETLPLKLDPSAEETVINNKEVLDSLGSSLDKMCHSAQMDNKSEIQLWLLKRIQ

VPIED - UNI36499 - DILPSKEEKSKTPPMFLCIKVGKPMRKSFASHTATMVQQYSKRRKQPEYWFAVPRER - UNI36499 - RVDHLYTFFV

QWSPDVYGKDAKEQGFVVVEKEELNMIDNFFSEPTTKSWE - UNI36499 - IITVEEAKRRKSTCSYYEEEEEEEEGLPILQPHSALLENMHIEQ L

ARRLPARVQGYPWRLAYSTLEHGTSLKTLYRKSASLDSPVLLVIKDMDNQ IFGAYATHPFKFSDHYYGTGETFLYTFSPNFK VFKWSGENSYFINGDI

SSLELGGGG - UNI36545 - GGRFGLWLDADLYHGRSNSCSTFNNDILSKKEDFIVQDLEVWTFE
Transcript ENSMUST00000105514
Sequence
GAAAAAAAAACACCCAGTGTAGGTCAGCCTGACAGTCAGTGGCTGGTGTGCAGGCAACCAGAGAAAGACCGATTCTTCTCTGTGGACAGTCTTCTGTCCC

AGCACCATGAGAGGCAGAGGACTGCCCCTGGACATTCAGATTTTCTATTGTGCCAGGCCTGACCAAGAGCCTTTTGTGAAG ATCATCACAGTTGAGGAG

GCAAAACGCAGGAAGAGCACTTGCAGCTACTACGAGGAAGAGGAAGAAGAGGAAGAGGGACTGCCTATCCTACAGCCCCACAGTGCACTCCTGGAAAACA

TGCACATCGAACAG CTGGCCCGACGACTTCCAGCCAGGGTACAAGGCTATCCATGGAGACTGGCCTACAGCACATTAGAGCATGGAACGAGCTTGAAGA

CTCTCTACAGGAAATCAGCATCTCTAGATAGTCCTGTTCTTTTGGTCATCAAAGACATGGATAACCAG ATATTTGGGGCATATGCAACTCATCCCTTCA

AGTTCAGTGACCACTATTATGGCACAGGCGAAACGTTTCTCTACACCTTTAGTCCGAATTTCAAG - UNI36545 - CCCATCTCTCACCTTGGCCAT

TGA
Translation
MRGRGLPLDIQIFYCARPDQEPFVK IITVEEAKRRKSTCSYYEEEEEEEEGLPILQPHSALLENMHIEQ LARRLPARVQGYPWRLAYSTLEHGTSLKT

LYRKSASLDSPVLLVIKDMDNQ IFGAYATHPFKFSDHYYGTGETFLYTFSPNFK - UNI36545 - PISHLGH

For any suggestions or comments, please send an email to unitrap@crg.es