Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000039704 (Lmbrd2)
Chromosomal location
Chr 15: 9070377 - 9128074 (+)
Description
LMBR1 domain containing 2 Gene [Source:MGI Symbol;Acc:MGI:2444173]
RefSeq_dna
NM_177178 
RefSeq_peptide
NP_796152.2 
UniGene
Mm.259886 
MGI
MGI:2444173 
Uniprot/SWISSPROT
Q8C561 
Human Ortholog
ENSG00000164187 (LMBRD2)
Omim not available
UniTrap UNI22938
Vector Insertion
Chr 15: 9070497 - 9078731
Public Clones (sanger)
Private Clones OST280713 (lexicon) OST149296 (lexicon) OST118613 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30782
Vector Insertion
Chr 15: 9087180 - 9095543
Public Clones IST14232C4 (tigm) IST10336E6 (tigm) IST10873D2 (tigm) IST14958A9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36626
Vector Insertion
Chr 15: 9095619 - 9100852
Public Clones IST12513A9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 39% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30887
Vector Insertion
Chr 15: 9113713 - 9116351
Public Clones IST11541C9 (tigm) IST13651A2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27945
Vector Insertion
Chr 15: 9116458 - 9124430
Public Clones not available
Private Clones OST43496 (lexicon)
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000090380
Sequence
CGGGCCTTCGGGTGATCACCGCCACGGTCGCCCGGGACTGAAGGATCCGTGACCCCGGCAGGCTGCGGCGGACGCGAAGCTTCTGAGTCCCTTCCAGACG

CTGTCTGGCGAGGTCCGACG - UNI22938 - ATATGGTCCAGAACTACCCATGAGTCAGTTTGGCTGGAGCTCGTGAGCATTCAATAATGAGTGGTG

CGGCTTTAGGACTTGAGATTGTTTTTGTCTTTTTTCTGGCATTGTTCCTCCTGCATCGCTATGGAGACTTTAAGAAACAGCACAGACTGGTAATCATCGG

CACACTGCTTGCTTGGTATCTCTGCTTTCTCATTGTCTTCATACTGCCGCTGGATGTCAGTACG ACAATATATAACCGATGCAGGCATGCTGCTGCAAA

TTCCAGCCCTCCTGAAAATACCAACGTTACGGGACTGGATGCATCTGTCACTCCAGCTCCAAG ACAGCATCCATGTTTCAAGCCGTGGAGTTACATTCC

AGATGGAATCATGCCAATTTTCTGGAGGGTAGTTTATTGGACATCACAGTTTTTGACGTG GATCCTGTTACCTTTTATGCAGTCATATGCAAGATCTGG

AGGTTTCTCCATCACCGGCAAGATCAAAACAGCCCTGATTGAGAATGCCATCTATTACGGCACTTACTTGCTGATATTTGGAGCATTTCTGATTTACGTA

GCTGTAAACCCACGTTTGCATTTAGAATG GAACCAACTTCAGACGATTGGGATAGCTGCTGCCAACACATGGGGTCTGTTTCTCCTTGTGTTATTATTG

GGGTATGGATTGGTGGAAATTCCTCGGTCATACTGGAATGGAGCCAAAAGGGGTTATCTTCTTATGAAGACTTACTTTAAGGCAGCCAAACTGATGACAG

AGAAGGCAGATGCAGAAGAGAATTTGGAGGATGTAATGGAG - UNI30782 - GAGGTTCGTAAAGTAAATGAGAGCATCAAGTACAACCACCCACTG

AGGAAGTGTGTAGACACAATACTTAAAAAG - UNI36626 - TGCCCTACAGATTATCAGGAAAAGATGGGTAGGAATATGGATGACTATGAAGATTT

TGACGAAAAGCGCAATACCTACCCAAGTGAAAAAAGTTTGGTAAAATTGCATAAACAG GTGATTTATTCAGTTCAAAGGCACCGTCGGACTCAAGTGCA

ATGGCAGATTCTTTTGGAACAGGCATTCTATCTAGAAGATGTAGCAAAAAATGAAACTAGCGCAACTCACCAGTTTGTTCACACCTTTCAGTCACCTGAG

CCAGAAAATCGATTTATCCAATATTTTTATAATCCTACTGTTG AGTGGTACTGGGAATGCCTTTTGCGTCCATGGTTTCACAGGACCCTTGCTGTGGTT

TTGTCTATCTTCTCTGTGATTGTTGTGTGGTCAGAGTGTACCTTCTTTAGCACAACTCCTGTCTTATCCCTTTTTGCAGTATTCATACAGCTGGCAGAAA

GAACATACAATTACATTTATATTGAG ATTGCTTGCTTCCTTTCCATCTTCTTCTTAAGCATCTGTGTTTACTCTACTGTGTTCAGGATCCGCGTGTTTA

ACTACTACTACCTGGCCTCACACCATCAGACCGATGCTTATAGCCTTCTGTTCAGTGGCAT GTTATTTTGCCGTTTGACTCCTCCTTTATGTCTTAACT

TCTTGGGATTGACCCATATGGATTCATCCATCTCCCACCAGAATACCCAGCCAACTGCATATACATCT ATCATGGGTTCCATGAAAGTTTTATCCTTTA

TTGCAGATGGATTCTATATATATTATCCTATGTTGGTAGTAATTCTCTGCATCGCTACGTATTTTAG TTTGGGCACCCGTTGTTTGAATCTGCTTGGTT

TCCAGCAGTTCATGGGAGATAATGATATGACATCAGATCTAGTTGATGAAGGAAAAGAATTAATCAGACGAG AGAAAAGAAAAAGGCAAAGACAAGAGG

AAGGTGAAAATAGAAGAAGA - UNI30891 - GAGTGGAAAGAACGTTATGGACACAACAGAGAGGATTCCACTCGGAACAGAAACGTCCATCCTGAC

CCCAAAGAGTCAAATTTCTCAGACACGACTACCAACTGGT - UNI27945 - CATCCAAATACACCAGGGCTAATAACAGGACTGAAAGAGACCGAAT

AGAACTTCTCCAGGATGCTGAGCCTCTGGATTTTAATGCAGAAACGTTTACGGATGAATCTCTGGAACCTGAGTCAGGAAG GTATCAACCTGGTGGGCG

ATATCTCTCCATGTCTTCCAGTATAATATTTGAAGATATCTAAAGTCTGAAGTAATTCTTGGATCAAGTAACCAAGGTCAACACATGAGCTCAGCCTTTA

TGAACATCTTTGTGCCCTGTATTTCCTCTGTTCTCTCTGTAAACGGTGTGAGGATAACAAAAACAGCATTGAAAACCGATCATATCTTAACAATATTAGG

CTATAGTTTGTTGAATAGAGCATCCTCTTTTCTGATAGGCTTTATTGGGTACCATCTGAAGCATCTGCCTTAGAAGTGTAGTTAAGTGGAAGGATTCAAC

TCATGATAAACATAGAGCTAACTTGGTTTCATGCTAATTTTTTAGGAAAGTTATTTTAAAGTTCAATGAAGCCATAAGTCACACTAAATTCTACAATTTT

ATAACTGTAATTTAAATTTTTACTATTTCTTTAAAAATGTTCAACCTACATTTTCCAAAGAACTGAAAGTGAACTGAGACCTCAAATAATTACTGTATTC

ACTAAACTCATGTCTTAAAACAAGGTTTATGATTCAGACATAACTGAATGTAAACAGCTCTTCTTCAGATTTGTATACACTTACGTGGGATTGATTGTGC

ATGTACAATTAAGATGATTCTTCAATTGATAGTGTTAGTGTCCTGAGCATGTGTATTCTAATTGGGTGATGTATTATTCTTCTCCGTCTTTGTAGTAACT

GGATCTTTTTATGGTTTTGACATTATTGCTTTGTAAAAGATTTTCATTTCAGAGAAAAATATTCATCTTTAACATTTAGAATATTGACTTAATGCTAATC

ATTCCATCCAAGAAAAATCCTAAGTATTAATGATGAATAGATTTGTTTGTTTTATAGCCAAAGAGTTCCCCAGATTCTCTAATATTTAAATTTTTTTTAA

GATTTATTTTATTTACATAAGTACACAGTAGCTGTTTCCAGACACACCAGAAGAGGACATCAGACCCCTTTACAGATGGATGTGAGCCACCATGTGGTTG

CTGGGAATTGAACTCAGGACCTTTGGAAGAGCAGTCAATGCTTTTAACCTCTGAGCTCTCTCTCCAGCCCCAATTCTCTAATATTTAAAAGATGCCTGTT

TATGCTCCTTGTAAAGAAAACATCTGGCTGTTCAGCTATTGAATGGTAAAAATAAAAATAATCCATTTATGAGTATTGCTAACACTTAAATTATAGCATA

GAAAAAAACCCAGAAAAATGTATTTGAATGAAATATGTAGTAATAACTTGTTTGTTAAACATGCTTATTATTTTAGATTGGTTGTTTCAACCTTTGCATT

TAAGCCAAAGTTGGGTATTATGTTTTAAAGAGCCAGTGTTTTATTCCCAAATGAACATGGCTTAGCATGTGTTAGCAGGGATTGTTCTATTTGTGTTTCT

CACAGAATACGTTCTACATGGGGTGGTCAGACTTGAACTTGTCCAGGGCAGTTTCTCACCTGTTCCCCTGCAGTTATTACAAGTGCTCAAGTGTTACTCT

GTCATATGTCGAGGACATAGTTCTATGTAGGTACTGAAAGGAAGTATTCATTTCTCATTATCTTTTTTTTTAAATGGTTGCATTTTTTATGACCTTCCAT

ATAGATTCCCCCTTTAAATCATTATCAATAGATAGATTTACTCTG
Translation
 - UNI22938 - MSGAALGLEIVFVFFLALFLLHRYGDFKKQHRLVIIGTLLAWYLCFLIVFILPLDVST TIYNRCRHAAANSSPPENTNVTGLDAS

VTPAPR RQHPCFKPWSYIPDGIMPIFWRVVYWTSQFLTW WILLPFMQSYARSGGFSITGKIKTALIENAIYYGTYLLIFGAFLIYVAVNPRLHLEW W

NQLQTIGIAAANTWGLFLLVLLLGYGLVEIPRSYWNGAKRGYLLMKTYFKAAKLMTEKADAEENLEDVME - UNI30782 - EVRKVNESIKYNHPLR

KCVDTILKK - UNI36626 - CPTDYQEKMGRNMDDYEDFDEKRNTYPSEKSLVKLHKQ VIYSVQRHRRTQVQWQILLEQAFYLEDVAKNETSATHQ

FVHTFQSPEPENRFIQYFYNPTVE EWYWECLLRPWFHRTLAVVLSIFSVIVVWSECTFFSTTPVLSLFAVFIQLAERTYNYIYIE IACFLSIFFLSIC

VYSTVFRIRVFNYYYLASHHQTDAYSLLFSGM MLFCRLTPPLCLNFLGLTHMDSSISHQNTQPTAYTS IMGSMKVLSFIADGFYIYYPMLVVILCIAT

YFS SLGTRCLNLLGFQQFMGDNDMTSDLVDEGKELIRRE EKRKRQRQEEGENRRR - UNI30891 - EWKERYGHNREDSTRNRNVHPDPKESNFS

DTTTNWS - UNI27945 - SSKYTRANNRTERDRIELLQDAEPLDFNAETFTDESLEPESGR RYQPGGRYLSMSSSIIFEDI

For any suggestions or comments, please send an email to unitrap@crg.es