Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000039715 (Wdr34)
Chromosomal location
Chr 2: 29887159 - 29904399 (-)
Description
WD repeat domain 34 Gene [Source:MGI (curated);Acc:Wdr34-001]
RefSeq_peptide
NP_001008498.2 
UniGene
Mm.88053 
MGI
MGI:1919070 
Uniprot/SWISSPROT
Q5U4F6 
Uniprot/SPTREMBL
A2BE91 
Human Ortholog
ENSG00000119333 (WDR34)
Omim not available
UniTrap UNI8009
Vector Insertion
Chr 2: 29893947 - 29904203
Public Clones (sanger) RRI494 (baygenomics) IST14857C6 (tigm) IST14336G10 (tigm)
IST14147E10 (tigm) IST14442C12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17639
Vector Insertion
Chr 2: 29893694 - 29893947
Public Clones not available
Private Clones OST439184 (lexicon) OST438897 (lexicon) OST428429 (lexicon) OST417602 (lexicon)
OST321418 (lexicon) OST286097 (lexicon) OST241723 (lexicon) OST202281 (lexicon)
OST193757 (lexicon) OST192516 (lexicon) OST191982 (lexicon) OST187516 (lexicon)
OST177083 (lexicon) OST143779 (lexicon) OST129809 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21488
Vector Insertion
Chr 2: 29890393 - 29893694
Public Clones not available
Private Clones OST329091 (lexicon) OST292088 (lexicon) OST210417 (lexicon) OST167002 (lexicon)
OST132934 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17508
Vector Insertion
Chr 2: 29889484 - 29890282
Public Clones not available
Private Clones OST441352 (lexicon) OST230185 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26747
Vector Insertion
Chr 2: 29887493 - 29887592
Public Clones not available
Private Clones OST100061 (lexicon)
Severity of mutation (?) Insertion after 81% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000045622
Sequence
GACCGTCGCCATGGCAATGTGCGCGTCGCCCAGGCCTTTTCGGCGCGTTGGAAGCGCTGGAGCTGCTGCCCTGGCTGCTGGCGGGGCTGGCGGCGCCGAA

CGGCGAGGGCGGCCTGCGCCTCTTCAGGATGAGACCCTGGGCGTGGCGTCCGTGCCCTCGCAGTGGAGGAGCGTCCAGGGGATCCGCGGGGAGACG - U

NI8009 - - UNI17639 - AAAAGTTGCCAGACAGCGGGCATTGCCACAGCCGAGTCGTCTGCCCAGGCCCGGACACATGCAGATGCCCAGGTACAG

ACAGAGGCTCCCGAAGAGCCAGCGGCCATGGCTCCTGTTTCCCAGTATGACACCCTCAGGCTGGAAGCCTTTCTCCGGAGGGTGGAGGCCATGGTCATCC

GGGAGCTGAACAACAACTGGCAGAGTCATGCCTTCGATGGCTATGAGGTGAACTGGACTGAGCAGCAGCAGACG - UNI17639 - - UNI21488 -

 GTGTCCTGTCTGCACACCCTGGTCTACCCCCTAGCCCAAGGGCAGGGTCTGCATGTGACCGGCATTTCCTGGAACTCGACAGGCTCTGTGCTGGCCTGT

GCCTATGGTCG - UNI17508 - GCTAGATGATGGAGACTGGAGTACACTCAAGTCCTACGTGTGTACTTGGAACCTGGACCGCCAAGGCCTGAATCC

CCAGCAGCCATCAGTAGTGGTGGAGGTGCCGAGTGCTGTCATGTGCCTGGCCTTTCATCCCACACAGCCCTCCCACATTGCCG GGGGGCTGTATAGCGG

GGAAGTGCTGGTGTGGGACATGAGCCGACCTGAGGACCCACTGCTTTGGCGTACAGGTCTGACAGATGACACTCACACAGACCCAGTGTATCAG GTGCT

GTGGTTACCTGAACCCCGGCATAGCCACCGCTTCCAGGTACTGAGTGCGGCCACAGATGGCAAGGTGTTGCTCTGGAGAGGCAGTGGGGCCGGTCAGCTG

CGGCTCACCAAGGGCTTTGCCCTGGCTGTGCAGCAGCTGCCTCGGAGCACCAAGCTGAAGAAG CCACCCCGTGGAGAGACTGAGGTGGGGGTGACATCA

GTGGCCTTCTCCAGCTTTGACTCCAGCCTTTTCGTTCTGGGCACAGAAGGTGGCTTCCCCCTCAAGTGTTCCCTGGCGTCAGAGGTAGCTGCTCTCACTC

GGATGCCCAGCTCTGTGCCGCTGAGGGCCCCGGTGCAGTTCACCTTCTCTCCCCATGGTGGCCCCGTGTATTCTGTGAGCTGTTCCCCCTTTCACAG GA

ATCTCTTCCTGAGCGCTGGGACCGATGGCCACGTCCACCTGTACTCCATGCTGCAGGCTCAGCCCCTTACCTCACTGCAGCTCTCTCACAAGTACCTGTT

TGCTGTGCGCTGGTCCCCTGTGCGCCCCTTGGTTTTTGCTGCTGCTTCAGGGGAAG - UNI26747 - GTGATGTACAACTTTTTGACCTCCAGAAAA

GCTCACAGAAACCCACAGTTTCTATAACACAAACCCAAGATGGAAGTCCTGTCTACTGTCTCGAGTTTAACAGCCAGCAGACACAGCTCTTAGCCGCTGG

TGATGCTAAGGGCATGGTCAAAGTGTGGCAGCTGAGCACAGCCTTCACAGAACAAGGGCCCCGGGAGGTGGAGGACTTGGATCAGCTAGAAGCAGAAATC

ACTACCTGAGGGCTGGTGAGATGGCTCAGCGGGTAAGAGCACTGACTACTCTTCTGAAGGTCCTGAGTTCAAATCCCAGCAACCACATGGTGGCTCACAA

CCAA
Translation
 - UNI8009 - - UNI17639 - MVIRELNNNWQSHAFDGYEVNWTEQQQT - UNI17639 - - UNI21488 - VSCLHTLVYPLAQGQGLHV

TGISWNSTGSVLACAYGR - UNI17508 - RLDDGDWSTLKSYVCTWNLDRQGLNPQQPSVVVEVPSAVMCLAFHPTQPSHIAG GGLYSGEVLVWDM

SRPEDPLLWRTGLTDDTHTDPVYQ VLWLPEPRHSHRFQVLSAATDGKVLLWRGSGAGQLRLTKGFALAVQQLPRSTKLKK PPRGETEVGVTSVAFSSF

DSSLFVLGTEGGFPLKCSLASEVAALTRMPSSVPLRAPVQFTFSPHGGPVYSVSCSPFHR RNLFLSAGTDGHVHLYSMLQAQPLTSLQLSHKYLFAVRW

SPVRPLVFAAASGEG - UNI26747 - GDVQLFDLQKSSQKPTVSITQTQDGSPVYCLEFNSQQTQLLAAGDAKGMVKVWQLSTAFTEQGPREVEDLD

QLEAEITT
Transcript ENSMUST00000113711
Sequence
GACCGTCGCCATGGCAATGTGCGCGTCGCCCAGGCCTTTTCGGCGCGTTGGAAGCGCTGGAGCTGCTGCCCTGGCTGCTGGCGGGGCTGGCGGCGCCGAA

CGGCGAGGGCGGCCTGCGCCTCTTCAGGATGAGACCCTGGGCGTGGCGTCCGTGCCCTCGCAGTGGAGGAGCGTCCAGGGGATCCGCGGGGAGACG - U

NI8009 - - UNI17639 - AAAAGTTGCCAGACAGCGGGCATTGCCACAGCCGAGTCGTCTGCCCAGGCCCGGACACATGCAGATGCCCAGGTACAG

ACAGAGGCTCCCGAAGAGCCAGCGGCCATGGCTCCTGTTTCCCAGTATGACACCCTCAGGCTGGAAGCCTTTCTCCGGAGGGTGGAGGCCATGGTCATCC

GGGAGCTGAACAACAACTGGCAGAGTCATGCCTTCGATGGCTATGAGGTGAACTGGACTGAGCAGCAGCAGACG - UNI17639 - - UNI21488 -

 GTGTCCTGTCTGCACACCCTGGTCTACCCCCTAGCCCAAGGGCAGGGTCTGCATGTGACCGGCATTTCCTGGAACTCGACAGGCTCTGTGCTGGCCTGT

GCCTATGGTCG - UNI17508 - GCTAGATGATGGAGACTGGAGTACACTCAAGTCCTACGTGTGTACTTGGAACCTGGACCGCCAAGGCCTGAATCC

CCAGCAGCCATCAGTAGTGGTGGAGGTGCCGAGTGCTGTCATGTGCCTGGCCTTTCATCCCACACAGCCCTCCCACATTGCCG GGGGGCTGTATAGCGG

GGAAGTGCTGGTGTGGGACATGAGCCGACCTGAGGACCCACTGCTTTGGCGTACAGGTCTGACAGATGACACTCACACAGACCCAGTGTATCAG GTGCT

GTGGTTACCTGAACCCCGGCATAGCCACCGCTTCCAGGTACTGAGTGCGGCCACAGATGGCAAGGTGTTGCTCTGGAGAGGCAGTGGGGCCGGTCAGCTG

CGGCTCACCAAGGGCTTTGCCCTGGCTGTGCAGCAGCTGCCTCGGAGCACCAAGCTGAAGAAG CCACCCCGTGGAGAGACTGAGGTGGGGGTGACATCA

GTGGCCTTCTCCAGCTTTGACTCCAGCCTTTTCGTTCTGGGCACAGAAGGTGGCTTCCCCCTCAAGTGTTCCCTGGCGTCAGAGGTAGCTGCTCTCACTC

GGATGCCCAGCTCTGTGCCGCTGAGGGCCCCGGTGCAGTTCACCTTCTCTCCCCATGGTGGCCCCGTGTATTCTGTGAGCTGTTCCCCCTTTCACAG GA

ATCTCTTCCTGAGCGCTGGGACCGATGGCCACGTCCACCTGTACTCCATGCTGCAGGCTCAGCCCCTTACCTCACTGCAGCTCTCTCACAAGTACCTGTT

TGCTGTGCGCTGGTCCCCTGTGCGCCCCTTGGTTTTTGCTGCTGCTTCAGGGGAAG - UNI26747 - GTGATGTACAACTTTTTGACCTCCAGAAAA

GCTCACAGAAACCCACAGTTTCTATAACACAAACCCAAGATGGAAGTCCTGTCTACTGTCTCGAGTTTAACAGCCAGCAGACACAGCTCTTAGCCGCTGG

TGATGCTAAGGGCATGGTCAAAGTGTGGCAGCTGAGCACAGCCTTCACAGAACAAGGGCCCCGGGAGGTGGAGGACTTGGATCAGCTAGAAGCAGAAATC

ACTACCTGAGGGCTGGTGAGATGGCTCAGCGGGTAAGAGCACTGACTACTCTTCTGAAGGTCCTGAGTTCAAATCCCAGCAACCACATGGTGGCTCACAA

CCAA
Translation
MAMCASPRPFRRVGSAGAAALAAGGAGGAERRGRPAPLQDETLGVASVPSQWRSVQGIRGET - UNI8009 - - UNI17639 - KSCQTAGIATAE

SSAQARTHADAQVQTEAPEEPAAMAPVSQYDTLRLEAFLRRVEAMVIRELNNNWQSHAFDGYEVNWTEQQQT - UNI17639 - - UNI21488 - V

SCLHTLVYPLAQGQGLHVTGISWNSTGSVLACAYGR - UNI17508 - RLDDGDWSTLKSYVCTWNLDRQGLNPQQPSVVVEVPSAVMCLAFHPTQPS

HIAG GGLYSGEVLVWDMSRPEDPLLWRTGLTDDTHTDPVYQ VLWLPEPRHSHRFQVLSAATDGKVLLWRGSGAGQLRLTKGFALAVQQLPRSTKLKK 

PPRGETEVGVTSVAFSSFDSSLFVLGTEGGFPLKCSLASEVAALTRMPSSVPLRAPVQFTFSPHGGPVYSVSCSPFHR RNLFLSAGTDGHVHLYSMLQA

QPLTSLQLSHKYLFAVRWSPVRPLVFAAASGEG - UNI26747 - GDVQLFDLQKSSQKPTVSITQTQDGSPVYCLEFNSQQTQLLAAGDAKGMVKVW

QLSTAFTEQGPREVEDLDQLEAEITT

For any suggestions or comments, please send an email to unitrap@crg.es