Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000039716 (Dock3)
Chromosomal location
Chr 9: 106797711 - 107134190 (-)
Description
dedicator of cyto-kinesis 3 Gene [Source:MGI Symbol;Acc:MGI:2429763]
RefSeq_dna
NM_153413 
RefSeq_peptide
NP_700462.2 
UniGene
Mm.150259 
MGI
MGI:2429763 
Uniprot/SWISSPROT
Q8CIQ7 
Uniprot/SPTREMBL
Q3UHH9 
Human Ortholog
ENSG00000088538 (DOCK3)
Omim 143465 - ATTENTION DEFICIT-HYPERACTIVITY DISORDER  
UniTrap UNI27694
Vector Insertion
Chr 9: 107081496 - 107133802
Public Clones not available
Private Clones OST53114 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000044532
Sequence
GCTGAGGCGATCCGAGCCGCGGCGGCGCCGGGAAGCCAGCGACGGAGCTGTGAGGGACCGAACGGCGGCGCGGGGACGGTGGAGACGGACAGGTGGTGAG

CCCTCGCCCGCGTCGCCAGGGGCTCCTCGGCCGCCCGTGGAGTCTCGCGGTCGGTCAGGACGTGGCATCCGGCGGTGGCGGTGGCATCCCGGACGGCCTG

TGAGGGATGCGCCGCCTACTGCCCCGCGCCGCCTGACCGCCCCCGCCTTGCCTCGCGGTGCGCCACAGCCGGGCCCGCGGCCGCCCCTGCGGCCGTCCCC

TGCGAGCTGTCACCCAGCCGCCGCGCCCGCGGGGCTGCGCCCGGCCCGGCCATGTGGACCCCCACGGAGGAGGAGAAATACGGCGTAG - UNI27694 

- TGATATGCAGCTTTCGAGGATCTGTCCCTCAAGGCCTGGTCTTAGAAATAGGAGAAACAGTTCAGATTCTTGAAAAATGTGAAG GTTGGTACAGAGG

AGTTTCAACAAAGAAGCCTAATGTAAAG GGGCTCTTTCCTGCAAATTATATTCATTTGAAAAAGGCAATTGTCAGTAACAGGGG GCAGTATGAAACTG

TGGTTCCGCTGGAAGATTCTATTGTGACTGAAGTTACAACAACTCTACAAGAGTGGGCCAGTCTGTGGAAACAACTATATGTG AAACACAAAGTAGATC

TTTTCTACAAACTCCGCCATGTGATGAATGAACTTATTGACCTGCGAAGGCAGCTACTGTCTGGTCACCTGACACAGGATCAGGTGCGGGAGGTTAAGCG

GCACATCACCGTGCGTCTGGACTGGGGTAATGA GCATTTGGGCCTGGACTTGGTGCCTCGGAAGGACTTTGAAGTAGTGGATTCAGACCAGATTAGCGT

CTCAGATCTCTATAAAATG CATTTATCTAGCCGGCAGAGTGTACAGCAGAGCACATCCCAA GTAGATACAATGCGCCCAAGGCATGGGGAAACCTGTC

GAATGCCGGTACCACATCATTTCTTCTTCAGCCTGAAGAGTTTCACCTATAATACCATTGGTGAAGATAGTGATGTCTTCTTTTCTCTGTATGACATGAG

AGAAGGCAAGCAGATCAG TGAACGGTTTCTGGTGAGACTGAACAAGAATGGTGGGCCAAGGAACCCAGAGAAGATAGAACGAATGTGTGCCCTTTTTAC

A GATCTGAGCAGCAAAGATATGAAGAGAGATTTATACATAGTTGCCCATGTGATCCGAATAG GCCGGATGCTCCTGAATGACTCCAAAAAGGGTCCTG

CTCACCTGCACTACAGGCGACCATATGGCTGTGCGGTTCTAAGCATATTGGATGTTCTACAGTCACTAACAGAATTAAAAGAAGAAAAGGATTTTGTTCT

TAAGGTGTACAC ATGTAACAACGAGAGTGAATGGACCCAGATTCATGAGAACATCATCCGAAAGTCAAGTACCAAGTACTCTGCCCCCAGTGCCAGCCA

TG GTCTTATTATTTCCCTTCAGCTTTTTCGTGGTGACATGGAACAGATCCGGAGAGAAAATCCCATGATATTTAATAGAGGATTAGCAATTACAAGAAA

ATTGGGATTTCCTGATGTTATTATGCCAG GTGATATCCGCAATGATTTGTACCTAACACTGGAGAAGGGAGACTTTGAAAGAGGGGGAAAGAGTGTACA

AAAGAATATTGAAGTAACCATGTATGTACTTTATGCAGATGGAGAAATCTTGAAG GACTGTATCAGTTTGGGTTCAGGAGAGCCAAATAGGAGTTCCTA

TCACTCCTTTGTTCTCTACCACAGTAATAGTCCTCGCTGGGGAGAAATTATCAAATTACCTATTCCCATTGACAGATTCCGGGGCTCCCATCTCCGCTTT

GAGTTCAGACATTGTTCCA CAAAGGACAAAGGGGAAAAGAAACTCTTTGGCTTTGCGTTCTCTCCGCTGATGCGTGATGATGGCACCACACTCTCAGAT

GATATTCATGAGCTTTATGTGTATAAG TGTGATGAGAATAGCACATTTAACAACCATGCCCTCTACCTGGGCCTGCCCTGCTGCAAAGAAGACTACAAT

GGCTGCCCTAATATCCCCTCCAGCCTCATCTTCCAGCGCAGCGCCAAAGAGTCTTTCTTCATTTCTACACAACTCTCTTCTACCAAACTCACACAAAATG

 TGGACCTCCTTGCTCTGCTGAAATGGAAGGCCTTCCCAGACCGGATCATGGACATATTAGGGCGGTTGCGGCATGTCAGTGGGGAAGAAATTGTTAAG 

TTTCTGCAGGATATCTTAGATACACTCTTTGTGATTTTGGATGACAATACAGAAAAATACGGCCTTTTGGTTTTTCAGTCTCTG GTTTTCATTATCAAC

CTGCTTCGAGACATAAAATACTTCCACTTCCGACCTGTAATGGACACATATATCCAGAAGCACTTTGCTGGAGCCCTGGCATATAA GGAGCTCATCCGC

TGTTTGAAGTGGTACATGGACTGCTCAGCAGAACTGATTCGACAGGACCACATTCAGGAAGCCATGCGG GCCTTGGAGTACCTTTTCAAGTTCATTGTG

CAGTCACGAATCCTGTATTCGAGAGCCACATGTGGGATGGAAGAGGAGCAGTTCCGGTCTAGCATCCAGGAACTTTTCCAGTCCATCCGGTTTGTGCTGA

GTCTGGACAGTAGGAACTCAGAAACACTGCTCTTCACTCAG GCTGCACTACTCAACTCCTTCCCCACCATCTTCGACGAGCTGCTACAGATGTTTACGG

TGCAAGAGGTAGCAGAGTTTGTGAGAGGCACACTGGGAAGCATGCCTAGCACTGTGCACATCGGGCAGTCAATGGATGTGGTGAAGCTGCAGTCCATCGC

CAGGACAGTGGATAGTCGCCTATTTTCATTTTCAG AATCCCGCCGCATCCTACTTCCTGTGGTTCTTCATCACATTCATCTTCACCTGAGGCAACAGAA

AGAGTTGCTAATCTGCTCAGGGATTCTGGGCAGCATCTTCTCCATCGTCAAGACCAGCTCTCTG GAGGCAGATGTCATGGAGGAGGTAGAGATGATGGT

GGAAAGCCTCCTGGATGTTCTCCTACAGACTCTCCTCACCATCATGAGTAAATCACATGCTCAGGAGGCGGTAAGAGGGCAGCGGTGCCCGCAGTGCACA

GCCGAGATCACT GGTGAATATGTGTCCTGCCTCCTCTCATTGCTCCGTCAGATGTGTGACACCCATTTCCAACACCTCTTAGACAACTTTCAGAGTAAA

GATGAACTAAAG GAATTTCTGCTGAAGATTTTCTGTGTGTTCAGAAACCTAATGAAGATGAGTGTCTTCCCTCGAGACTGGATGGTGATGAGACTGTTG

ACAAGCAA CATTATAGTCACTACTGTCCAGTACCTGTCCTCTGCACTGCATAAGAATTTCACAGAAACAGACTTTGACTTCAAG GTGTGGAATTCTTA

TTTTAGCCTGGCAGTTCTGTTCATAAACCAGCCAAGCCTTCAGCTAGAAATCATTACTTCAGCCAAGAGGAAGAAGATTCTAGATAA GTATGGGGACAT

GCGTGTGATGATGGCATATGAACTGTTCAGCATGTGGCAGAATCTGG GTGATCATAAGATCCACTTTATTCCTGGAATGATTGGTCCTTTCCTGGGTGT

GACACTGGTCCCACAGCCAGAAGTGCGGAATATCATGATTCCTATCTTTCATGACATGATGGACTGGGAACAAAGGAAAAATGGCAACTTCAAGCAG GT

GGAGGCTGAGCTGATTGACAAGCTGGACAGCATGGTGTCAGAGGGGAAAGGTGATGAGAGCTACAGGGAACTCTTCGGCCTGCT AACCCAGCTGTTTGG

GCCCTACCCCAG CCTTCTGGAAAAGGTTGAACAGGAAACATGGCGTGAGACTGGCATTTCCTTTGTTACCTCAGTCACGCGCCTCATGGAACGCCTTCT

TGACTACAG GGACTGCATGAAGGGAGAAGAAACTGAGAACAAGAAGGTTGGCTGCACTGTTAACCTGATG AACTTTTACAAATCTGAGATTAACAAAG

AGGAAATGTATATCCGATACATCCATAAACTTTGTGACATGCACTTACAGGCTGAGAACTACACAG AGGCTGCATTCACCCTGCTTCTTTACTGCGAGC

TGCTACAATGGGAAGACCGGCCATTACGGGAGTTCCTACACTACCCATCCCAAACTGAGTGGCAGCGGAAAGAGGGACTGTGTAGAAAGATCATCCACTA

CTTCAACAAAGGCAAG AGCTGGGAGTTTGGAATTCCTCTATGTAGAGAGCTGGCATGCCAGTACGAGAGCCTCTATGACTACCAGAGCCTCAGCTGGAT

CCGG AAAATGGAGGCCAGCTACTATGACAACATCATAGAGCAGCAACGCCTGGAACCTGAGTTCTTCCGGGTTGGTTTTTATGGCAGGAAGTTTCCTTT

CTTCCTTCGG AACAAAGAATATGTGTGCCGTGGTCATGACTACGAGAGGCTAGAAGCCTTCCAACAGAGGATGCTGAGCGAGTTCCCACAGGCCGTTGC

TATGCAGCACCCCAATCATCCTGATGATGCCATCCTACAGTGTGATGCTCAGT ATTTACAGATCTATGCAGTGACACCTATTCCAGATTACGTGGATGT

TCTACAAATGGATAGAGTACCTGATCGTGTCAAGAGCTTCTATCGTGTCAATAATGTGAGGAAGTTCCGGTATGATAGACCTTTCCACAAAGGCCCCAAG

GACAAAGACAATGAATTCAAG AGCCTGTGGATTGAGCGCACCACGCTGACACTGACCCACAGTTTGCCTGGCATCTCTCGGTGGTTTGAAGTGGAAAGA

AGGGAACTG GTGGAGGTGAGCCCTCTGGAGAATGCAATCCAGGTAGTTGAGAATAAGAACCAGGAACTGCGAGCTCTGATCAGCCAGTATCAGCACAAG

CAGGTACATGGCAACATCAATCTGCTCAGCATGTGCCTGAACGGAGTCATTGACGCTGCTGTCAATGGAGGCATTGCACGCTACCAGGAG GCCTTTTTT

GATAAAGATTATATCACCAAGCACCCAGGAGACGCTGAGAAGATCTCCCAGCTCAAAGAACTAATGCAGGAACAG GTCCATGTTCTTGGAGTTGGGCTG

GCGGTTCATGAGAAGTTTGTGCATCCGGAAATGCGGCCTCTGCATAAGAAGCTGATTGATCAGTTCCAGATGATGAGGGCCAGTCTGTACCAT GAGTTT

CCAGGTTTGGATAAGCTAAGTCCTGCATGTTCAGGCACCAGCACCCCACGGGGAAATGTTCTGGCATCCCATAGCCCCATGAGCCCTGAGAACATCAAGA

TGACCCACAGGCACAG CCCCATGAACTTGATGGGCACAGGCCGCCATTCCTCATCCTCTCTCTCCTCACATGCATCTAGTGAAGCAGGAAACATGATGA

TGATGGGTGACAACTCTATGGGTGAAGCTCCTGAAGACCTCTACCACCACATGCAG CTTGCATATCACAACCCCAGGTACCAGGGCTCAGTCACCAACG

TCTCTGTTCTGTCCTCGTCCCAGGCAAGCCCTTCTTCCTCCAGCCTGAGTTCTACACATTCAGCTCCGTCCCAGATGATCACCTCTGCCCCTTCCAGCAC

CCGAG GCTCTCCCTCTCTGCCAGATAAGTACCGACATGCCCGGGAAATGATGTTGCTGTTGCCTACACATCGGGACCGCCCAAGCAGTGCCATGTATCC

AGCAGCCATCCTAGAGAATGGACAG CCACCAAACTTCCAGCGGGCCCTGTTCCAGCAAGTAGTTGGAGCCTGTAAACCCTGCAGTGACCCCAATCTGTC

TATGGCTGAAAAAG GTCATTACTCCCTACACTTCGACGCCTTCCACCACCCTCTGGGTGATACCCCCCCGGCCCTCCCTGCCCGGACACTGCGCAAG T

CTCCTCTCCACCCCATCCCAGCCTCCCCTACAAGCCCCCAATCGGGCCTGGATGGCAGCAACTCCACGCTGTCTGGCAGCGCCAGTAGCGGTGTATCCTC

CTTAAGTGAGAGTAACTTTGGGCATTCCTCAGAGGCCCCACCTCGAACAGACACCATGGACTCCATGCCAAGCCAGGCCTGGAATGGCGATGAAGACCTT

GAGCCGCCCTACCTCCCTGTCCACTACAGCCTCTCTGAATCTGCTGTCCTTGATGCCATCAAGTCCCAGCCATGCAGGAGCCACTCAGCCCCAGGGTGTG

TCCTCCCTCAGGATCCCATGGACCCACCTGCGCTGCCACCCAAGCCCTATCACCCCCGCCTGCCAGCCCTAGAGCATGATGAGGGTATGCTATTGCGGGA

GGAGGCTGAGAGGCCAAGGGGCCTGCACCGCAAGGCCTCCCTGCCTCCTGGAAGTGTCAAGGAGGAACAGGCCCGCCTGGCCTGGGAGCACGGCCGAGGG

GAACAGTGAGAAGCAGAGAGGCA
Translation
MWTPTEEEKYGVV - UNI27694 - VICSFRGSVPQGLVLEIGETVQILEKCEG GWYRGVSTKKPNVK GLFPANYIHLKKAIVSNRG GQYETVVP

LEDSIVTEVTTTLQEWASLWKQLYV KHKVDLFYKLRHVMNELIDLRRQLLSGHLTQDQVREVKRHITVRLDWGNE EHLGLDLVPRKDFEVVDSDQISV

SDLYKM HLSSRQSVQQSTSQ VDTMRPRHGETCRMPVPHHFFFSLKSFTYNTIGEDSDVFFSLYDMREGKQIS SERFLVRLNKNGGPRNPEKIERMCA

LFT DLSSKDMKRDLYIVAHVIRIG GRMLLNDSKKGPAHLHYRRPYGCAVLSILDVLQSLTELKEEKDFVLKVYT TCNNESEWTQIHENIIRKSSTKY

SAPSASHG GLIISLQLFRGDMEQIRRENPMIFNRGLAITRKLGFPDVIMPG GDIRNDLYLTLEKGDFERGGKSVQKNIEVTMYVLYADGEILK DCIS

LGSGEPNRSSYHSFVLYHSNSPRWGEIIKLPIPIDRFRGSHLRFEFRHCST TKDKGEKKLFGFAFSPLMRDDGTTLSDDIHELYVYK CDENSTFNNHA

LYLGLPCCKEDYNGCPNIPSSLIFQRSAKESFFISTQLSSTKLTQNV VDLLALLKWKAFPDRIMDILGRLRHVSGEEIVK FLQDILDTLFVILDDNTE

KYGLLVFQSL VFIINLLRDIKYFHFRPVMDTYIQKHFAGALAYK KELIRCLKWYMDCSAELIRQDHIQEAMR ALEYLFKFIVQSRILYSRATCGMEE

EQFRSSIQELFQSIRFVLSLDSRNSETLLFTQ AALLNSFPTIFDELLQMFTVQEVAEFVRGTLGSMPSTVHIGQSMDVVKLQSIARTVDSRLFSFSE E

SRRILLPVVLHHIHLHLRQQKELLICSGILGSIFSIVKTSSL EADVMEEVEMMVESLLDVLLQTLLTIMSKSHAQEAVRGQRCPQCTAEIT GEYVSCL

LSLLRQMCDTHFQHLLDNFQSKDELK EFLLKIFCVFRNLMKMSVFPRDWMVMRLLTSN NIIVTTVQYLSSALHKNFTETDFDFK VWNSYFSLAVLFI

NQPSLQLEIITSAKRKKILDK KYGDMRVMMAYELFSMWQNLG GDHKIHFIPGMIGPFLGVTLVPQPEVRNIMIPIFHDMMDWEQRKNGNFKQ VEAEL

IDKLDSMVSEGKGDESYRELFGLL LTQLFGPYPS SLLEKVEQETWRETGISFVTSVTRLMERLLDYR RDCMKGEETENKKVGCTVNLM NFYKSEIN

KEEMYIRYIHKLCDMHLQAENYTE EAAFTLLLYCELLQWEDRPLREFLHYPSQTEWQRKEGLCRKIIHYFNKGK SWEFGIPLCRELACQYESLYDYQS

LSWIR KMEASYYDNIIEQQRLEPEFFRVGFYGRKFPFFLR NKEYVCRGHDYERLEAFQQRMLSEFPQAVAMQHPNHPDDAILQCDAQY YLQIYAVTP

IPDYVDVLQMDRVPDRVKSFYRVNNVRKFRYDRPFHKGPKDKDNEFK SLWIERTTLTLTHSLPGISRWFEVERREL VEVSPLENAIQVVENKNQELRA

LISQYQHKQVHGNINLLSMCLNGVIDAAVNGGIARYQE AFFDKDYITKHPGDAEKISQLKELMQEQ VHVLGVGLAVHEKFVHPEMRPLHKKLIDQFQM

MRASLYH EFPGLDKLSPACSGTSTPRGNVLASHSPMSPENIKMTHRHS SPMNLMGTGRHSSSSLSSHASSEAGNMMMMGDNSMGEAPEDLYHHMQ LA

YHNPRYQGSVTNVSVLSSSQASPSSSSLSSTHSAPSQMITSAPSSTRG GSPSLPDKYRHAREMMLLLPTHRDRPSSAMYPAAILENGQ PPNFQRALFQ

QVVGACKPCSDPNLSMAEKG GHYSLHFDAFHHPLGDTPPALPARTLRK SPLHPIPASPTSPQSGLDGSNSTLSGSASSGVSSLSESNFGHSSEAPPRT

DTMDSMPSQAWNGDEDLEPPYLPVHYSLSESAVLDAIKSQPCRSHSAPGCVLPQDPMDPPALPPKPYHPRLPALEHDEGMLLREEAERPRGLHRKASLPP

GSVKEEQARLAWEHGRGEQ

For any suggestions or comments, please send an email to unitrap@crg.es