Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000039717 (Ralyl)
Chromosomal location
Chr 3: 13776848 - 14143963 (+)
Description
RALY RNA binding protein-like Gene [Source:MGI Symbol;Acc:MGI:1924147]
RefSeq_peptide
NP_848746.1 
UniGene
Mm.422625 
MGI
MGI:1924147 
Uniprot/SWISSPROT
Q8BTF8 
Uniprot/SPTREMBL
Q8BJ85 
Human Ortholog
ENSG00000184672 (RALYL)
Omim not available
UniTrap UNI38219
Vector Insertion
Chr 3: 13777308 - 13946394
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34295
Vector Insertion
Chr 3: 13946533 - 14039713
Public Clones IST12518C1 (tigm) IST11842G4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36279
Vector Insertion
Chr 3: 14039790 - 14081207
Public Clones IST14568D7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34204
Vector Insertion
Chr 3: 14081241 - 14107218
Public Clones IST12301A9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108372
Sequence
AGCGAGCAACAGCCTCACTGCAAAGCAGGAGCAGAACCCGTCTCTTTGTCTCCGTGGTCAAACCAATTACTTCTTAGAAAGTCGGCATTTCCTTTTTCAG

AATGACCATGTACAGGAGCAAACGCAGGCATCAGAGAT - UNI34295 - ATATCAACATGGCAGGGGAACCCAAACCCTACAGACCAAAGCCTGGAA

GTAAGAGACCCCTGTCAGCCCTGTACAG - UNI36279 - GCTTGAATCAAAGGAGCCATTCCTGTCTGTTGG - UNI34204 - TGGTTACGTAT

TTGACTACGATTACTACAGAGATGATTTCTACAATCG GCTGTTTGATTACCATGGCCGTGTACCTCCGCCTCCTCGAGCTGTCATCCCACTCAAACGTC

CCAGAGTGGCTGTCACCACCACACGCAGGGGCAAAGGCGTCTTTTCCATGAAAGGGGGATCCAGATCTACTGTTGGTGGGTCATCTTCATCAGGCTCTAA

GT TGAAATCAGATGAGTTACAGACAATCAAGAAAGAATTAACTCAGATCAAAACCAAAATTGACTCCTTGCTGGGGCGCCTGGAGAAGATTGAGAAGCA

GCAAAAGGCAGAAGCAG AAGCTCAGAAGAAGCAATTGGAGGAGAGTATAGAGCTGATCCAAGACGAATGTGTGTCAGAGAATGCAGACCACTCCACAGA

GGAGCCTGCTGAAGGAGGGCAAGAAGCTGATGGAGGAGAGATGACTGATGGGGTAGAGGAGGACTTCGATGAAGATGGGGGTCACGAGCTG AAGATGCA

GGTTGTC
Translation
 - UNI34295 - MAGEPKPYRPKPGSKRPLSALYR - UNI36279 - RLESKEPFLSVG - UNI34204 - GGYVFDYDYYRDDFYNR RLFDY

HGRVPPPPRAVIPLKRPRVAVTTTRRGKGVFSMKGGSRSTVGGSSSSGSKL LKSDELQTIKKELTQIKTKIDSLLGRLEKIEKQQKAEAE EAQKKQLE

ESIELIQDECVSENADHSTEEPAEGGQEADGGEMTDGVEEDFDEDGGHEL KMQVV
Transcript ENSMUST00000108373
Sequence
ATGACGGGCAAAACACAAACAAGCAACATTACCAATAAGAATGACCCCAAGTCCATCAACTCCAGGGTTTTCATCGGCAATTTGAATACAGCCATCGTCA

AAAAGGTCGACATTGAAGCTATTTTTTCAAAGTATGGAAAAATCGTTGGCTGCTCTGTTCACAAAGGGTATGCTTTCGTTCAGTACATGAGTGAGCGTCA

TGCAAGAGCCGCAGTGGCTGGAGAAAACGCCAGGGTCATCGCAGGCCAGCCTCTTG TTAAAATCTCT
Translation
MTGKTQTSNITNKNDPKSINSRVFIGNLNTAIVKKVDIEAIFSKYGKIVGCSVHKGYAFVQYMSERHARAAVAGENARVIAGQPLV VKIS
Transcript ENSMUST00000081617
Sequence
ATGACGGGCAAAACACAAACAAGCAACATTACCAATAAGAATGACCCCAAGTCCATCAACTCCAGGGTTTTCATCGGCAATTTGAATACAGCCATCGTCA

AAAAGGTCGACATTGAAGCTATTTTTTCAAAGTATGGAAAAATCGTTGGCTGCTCTGTTCACAAAGGGTATGCTTTCGTTCAGTACATGAGTGAGCGTCA

TGCAAGAGCCGCAGTGGCTGGAGAAAACGCCAGGGTCATCGCAGGCCAGCCTCTTG - UNI34295 - ATATCAACATGGCAGGGGAACCCAAACCCT

ACAGACCAAAGCCTGGAAGTAAGAGACCCCTGTCAGCCCTGTACAG - UNI36279 - GCTTGAATCAAAGGAGCCATTCCTGTCTGTTGG - UNI3

4204 - TGGTTACGTATTTGACTACGATTACTACAGAGATGATTTCTACAATCG GCTGTTTGATTACCATGGCCGTGTACCTCCGCCTCCTCGAGCTG

TCATCCCACTCAAACGTCCCAGAGTGGCTGTCACCACCACACGCAGGGGCAAAGGCGTCTTTTCCATGAAAGGGGGATCCAGATCTACTGTTGGTGGGTC

ATCTTCATCAGGCTCTAAGT TGAAATCAGATGAGTTACAGACAATCAAGAAAGAATTAACTCAGATCAAAACCAAAATTGACTCCTTGCTGGGGCGCCT

GGAGAAGATTGAGAAGCAGCAAAAGGCAGAAGCAG AAGCTCAGAAGAAGCAATTGGAGGAGAGTATAGAGCTGATCCAAGACGAATGTGTGTCAGAGAA

TGCAGACCACTCCACAGAGGAGCCTGCTGAAGGAGGGCAAGAAGCTGATGGAGGAGAGATGACTGATGGGGTAGAGGAGGACTTCGATGAAGATGGGGGT

CACGAGCTG
Translation
MTGKTQTSNITNKNDPKSINSRVFIGNLNTAIVKKVDIEAIFSKYGKIVGCSVHKGYAFVQYMSERHARAAVAGENARVIAGQPLD - UNI34295 - 

DINMAGEPKPYRPKPGSKRPLSALYR - UNI36279 - RLESKEPFLSVG - UNI34204 - GGYVFDYDYYRDDFYNR RLFDYHGRVPPPPRAV

IPLKRPRVAVTTTRRGKGVFSMKGGSRSTVGGSSSSGSKL LKSDELQTIKKELTQIKTKIDSLLGRLEKIEKQQKAEAE EAQKKQLEESIELIQDECV

SENADHSTEEPAEGGQEADGGEMTDGVEEDFDEDGGHEL

For any suggestions or comments, please send an email to unitrap@crg.es