Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000039745 (Htatip2)
Chromosomal location
Chr 7: 57014523 - 57029345 (+)
Description
HIV-1 tat interactive protein 2, homolog (human) Gene [Source:MGI Symbol;Acc:MGI:1859271]
Human Ortholog
not available
Omim not available
UniTrap UNI35319
Vector Insertion
Chr 7: 57017538 - 57026179
Public Clones IST12637G12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000085272
Sequence
CCGGCTGGACCTCTTGGGGCTCCTTGCCGGGAGGGGAGACAGCGGGGCTGCAGGCGGCGAGATGCTCGGTCCCACGGTGCTGGGCACGGTCGTAGCCGCG

CTGGTGGCTTCAATGCTACTGTTGCAGAGTGGGGACGAGGGGTCCGGGGCTGCTCCCAG CATGGCGGACAAGGAAGCACTGCCGAAGCTTCGGGAAGAC

TTCAAGATGCAGAATAAATCCGTCTTTATTTTGGGCGCCAGCGGGGAAACTGGCAAAGTACTTTTAAAGGAAATCCTGGGACAGAACCTGTTTTCCAAAG

TAACGCTCATTGGTCGGAGGAAGCTCACCTTCGAGGAGGAAGCTTATAAAAATGTG AATCAAGAAGTGGTGGACTTTGAGAAGCTGGATGTCTATGCTT

CTGCCTTTCAAGGTCATGATGTTGGATTCTGTTGCCTGGGCACCACCAGAAGCAAGGCTGGAGCG - UNI35319 - GAAGGGTTTGTTCGTGTTGAC

CGAGATTATGTGCTCAAGTCTGCAGAGCTGGCGAAAGCAGGAGGGTGCAAACATTTCAACTTGCTGTCCTCCAGGGGGGCCGATAAGTCCAGCAGTTTCT

TATACCTACAAGTAAAG GGAGAAGTGGAAGCCAAGGTTGAAGAATTAAAGTTTGATCGACTCTCAGTGTTTCGGCCAGG AGTCCTACTGTGTGACAGG

CAAGAGTCTCGTCCAGGCGAATGGCTGGCTAGGAAATTCTTCGGCTCTCTGCCAGACTCTTGGGCCAGTGGGTACGCTGTGCCTGTGGTGACGGTGGTTA

GAGCGATGCTGAACAACCTGGTGAGTCCCAGCAGCGGACAAATGGAACTTCTGGAAAATAAGGCCATCCTCCACCTGGGGAAAGACAGGGATGTGCCCAA

ACTGTGACCATGCTGGAGGACATTCGTGAAAACCTCAGTGCCTGTCACCAAATCAGTCATTTGGGGGCTCTATAAAAAGTCTCTTTGTGGTCCTTTGTGG

TGTGCTTCTCCTTAGCCAAGCGGCTCCATCAGAAAATGGCACTACTCCACGTCAGTTGTTGAGAGCCCCGTTGCTCATGTAATCATCCAGGCAGCTTTTG

GAGAACAGGTTTATATCATAGACTTATACTTTGTAGGTTGCAAACAGGGATCTCTGGAGGTCCCGGTGCCTTTGGGTGTAAGGCCAGCTTTGAAGCACTC

CTCCAGGGCCACCTGAGCAGAGGGGCCCTAGCACTACAGGCAGTCTCGTCTCCTGGCGGCACGGTGCTGTTGGGCTGCATGTAGCTGAGTGAACACTGTG

CCTTGATTCTCTGTCAGCACAGAAGCTGTAAGACAAGCTTCTGTATTTCACCGAGG
Translation
MLGPTVLGTVVAALVASMLLLQSGDEGSGAAPS SMADKEALPKLREDFKMQNKSVFILGASGETGKVLLKEILGQNLFSKVTLIGRRKLTFEEEAYKNV

 NQEVVDFEKLDVYASAFQGHDVGFCCLGTTRSKAGA - UNI35319 - EGFVRVDRDYVLKSAELAKAGGCKHFNLLSSRGADKSSSFLYLQVK GE

VEAKVEELKFDRLSVFRPG GVLLCDRQESRPGEWLARKFFGSLPDSWASGYAVPVVTVVRAMLNNLVSPSSGQMELLENKAILHLGKDRDVPKL

For any suggestions or comments, please send an email to unitrap@crg.es