Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000039753 (Fbxl5)
Chromosomal location
Chr 5: 44135855 - 44212845 (-)
Description
F-box and leucine-rich repeat protein 5 Gene [Source:MGI (curated);Acc:Fbxl5-002]
RefSeq_dna
NM_178729 
RefSeq_peptide
NP_848844.1 
UniGene
Mm.25794 Mm.457823 Mm.456609 
MGI
MGI:2152883 
Uniprot/SWISSPROT
Q8C2S5 
Uniprot/SPTREMBL
Q3TAK6 Q14CG1 Q3TBA5 Q3V305 Q3UC66 
Human Ortholog
ENSG00000118564 (FBXL5)
Omim not available
UniTrap UNI33122
Vector Insertion
Chr 5: 44173203 - 44212846
Public Clones IST14767B4 (tigm) IST12318A8 (tigm) IST10566C7 (tigm) IST10922B10 (tigm)
IST10922A10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37669
Vector Insertion
Chr 5: 44164682 - 44173355
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19604
Vector Insertion
Chr 5: 44162072 - 44164682
Public Clones not available
Private Clones OST386421 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000121736
Sequence
AGGGGGGCGCGCCGCCTCTGCCCCGCGGCGAGGGTGTCTATGGAGAGGCGGCGGCCGCGGCTGCTGAGGCGGACGCTGAGGCAGTGGCGATGGCGCCCTT

CCCCGATGAAGTGGACGTCTTCACCGCCCCGCACTGGCGGATGAAGCAGCTGGTGGGGCGCTACTGCGACAAG - UNI33122 - CGCAGTCAGACCA

TATATAATGTACACTCTGACAATAAGCTCTCCGAGATGCTGAGTCTCTTTGAAAAGGGGCTGAAGAATGTCAAG - UNI19604 - AATGAGTACGAA

CAGTTAAATTATGCAAAACAGCTGAAAGAGAGATTGGAGGCTTTTACAAGAGATTTTCTTCCTCACATGAAAGAGGAAGAAGAG GTTTTTCAGCCCATG

TTAATGGAATATTTTACCTACGAGGAGCTTAAAGATATCAAAAAGAAAGTGATTGCACAGCACTGCTCACAGAAGGACACGGCAGAGCTCCTCAGAGGGC

TCAGTCTGTGGAACCAAGCTGAGGAGCGACAGAAAGTTCTCAAGTACTCTGTGGATGAGAAGGCAGATACAG AAGCGGAAGTGTCAGAACACTCCACAG

GTATAACCCATCTTCCTCCTGAGGTAATGCTGTCCATTTTCAGTTACCTTAATCCTCAAGAATTGTGTCGGTGTAGTCAAGTCAGTACTAAGTGGTCTCA

GCTGGCAAAAACAGGATCTTTGTGGAAACATCTTTACCCTGTTCATTGGGCAAGAG GTGACTGGTATAGTGGTCCTGCCACTGAACTTGATACTGAGCC

TGATGAGGAATGGGTGAGAAATAGGAAAGATGAAAGTCGTGCTTTCCAGGAGTGGGATGAAGATGCCGATATAGATGAATCTG AAGAGTCTGCAGAGGA

ATCGGTTGCTATCAGCATTGCACAAATGGAAAAACGTGTACTCCATGGCTTAATTCATAATGTTCTGCCATATGTTGGTACCTCTGTAAAAACTTTAGTG

TTAGCGTACAGCTCTGCAGTCTCCAGCAAAATG GTTAGGCAGATTTTAGAGCTTTGTCCTAACCTGGAACATCTGGATCTTACCCAGACCGACATTTCT

GATTCTGCATTTGACAG TTGGTCTTGGCTCGGTTGCTGCCAGAGTCTTCGGCATCTTGATCTGTCTGGATGTGAAAAAATCACAGACATGGCTCTAGAG

AAGATTTCTAGAGCTCTTGGAGTTCTGACATCTCATCAGAGTGGCTTTCTGAAAAGTGCAGGCAAGGCTGCTTCAACTCCATGGACAAGTAAAGACATTA

CCATGCCATCCACCACGCAGTATGCCTGTTTGCACAATTTAACTGACAAAGGCATTGGTGAAGAAATAGACAACGAGCACTCTTGGACTGAACCTGTGTC

TTCTGAAAGTTTGACTTCTCCTTATGTGTGGATGCTAGATGCTGAAGATTTGGCTGATATTGAAGATGCTGTAGAGTGGAGACACAGAAATGTTGAGAGT

CTCTGTGTGATGGAAACAGCCTCCAACTTTGGTTGTTCCTCATCTGGTTGTTACAGTAAGGACATTGTGGGATTAAGGACTAGTGTCTGTTGGCAGCAGC

ATTGTGCTTCTCCAGCCTTTGCATATTGTGGTCATTCATTCTGTTGTACAGGGACAGCTTTAAGAACTATGACTACACTCCCAGCGACTTCTGCAATGTG

TAGAAAAGCATTAAGGACTACATTGCCCAGGGGGAAAGACTTAATTTATTTTGGGAGTGAAAAGTCTGACCAAGAGACTGGACGAGTACTTTTGTTCCTC

AGTCTGTCTGGATGTTACCAGATCACAGACCATGGTCTCAGGTGGGTGATCAGCCCTAGTTGTTAGGAAATGGATGTATTTGCACATGAAATATTACATT

ACTGATCTAAGTTTTTCACTTGGCTTTTTTAAGCAAGAAAGTTAACCAAGGTTTGCTACAAGTATTGGAGTAATAGTGCTTCTGATACCAACATGAAGTT

TCATTTTAGTCAGTTCAAATACATTGTGGAATATAGAGGAATATACATTTAGAAGTTTAATTGCTTAGTAATTGGCCACATTACATTTTTATAATACAGT

TTGGTAGATAAATGTATAGGTTATAATCTCAAGGATATGTTACAGAAGTAAATTTTATATTGAGGACTTTGTCAACC
Translation
MAPFPDEVDVFTAPHWRMKQLVGRYCDK - UNI33122 - RSQTIYNVHSDNKLSEMLSLFEKGLKNVK - UNI19604 - NEYEQLNYAKQLKER

LEAFTRDFLPHMKEEEE VFQPMLMEYFTYEELKDIKKKVIAQHCSQKDTAELLRGLSLWNQAEERQKVLKYSVDEKADTE EAEVSEHSTGITHLPPEV

MLSIFSYLNPQELCRCSQVSTKWSQLAKTGSLWKHLYPVHWARG GDWYSGPATELDTEPDEEWVRNRKDESRAFQEWDEDADIDESE EESAEESVAIS

IAQMEKRVLHGLIHNVLPYVGTSVKTLVLAYSSAVSSKM VRQILELCPNLEHLDLTQTDISDSAFDS SWSWLGCCQSLRHLDLSGCEKITDMALEKIS

RALGVLTSHQSGFLKSAGKAASTPWTSKDITMPSTTQYACLHNLTDKGIGEEIDNEHSWTEPVSSESLTSPYVWMLDAEDLADIEDAVEWRHRNVESLCV

METASNFGCSSSGCYSKDIVGLRTSVCWQQHCASPAFAYCGHSFCCTGTALRTMTTLPATSAMCRKALRTTLPRGKDLIYFGSEKSDQETGRVLLFLSLS

GCYQITDHGLRWVISPSC
Transcript ENSMUST00000087465
Sequence
CCGCGGCGAGGGTGTCTATGGAGAGGCGGCGGCCGCGGCTGCTGAGGCGGACGCTGAGGCAGTGGCGATGGCGCCCTTCCCCGATGAAGTGGACGTCTTC

ACCGCCCCGCACTGGCGGATGAAGCAGCTGGTGGGGCGCTACTGCGACAAG - UNI33122 - CTTTCTAAAACCAACTTTTCCAACAACAATGACTT

CCGTGCTCTTCTCCAGTCTTTATATGCTACTTTCAAGGAGTTTAAAATGCATGAACAAATTGAAAATGAATACATTATCGGTTTACTTCAGCAGCGCAGT

CAGACCATATATAATGTACACTCTGACAATAAGCTCTCCGAGATGCTGAGTCTCTTTGAAAAGGGGCTGAAGAATGTCAAG - UNI19604 - AATGA

GTACGAACAGTTAAATTATGCAAAACAGCTGAAAGAGAGATTGGAGGCTTTTACAAGAGATTTTCTTCCTCACATGAAAGAGGAAGAAGAG GTTTTTCA

GCCCATGTTAATGGAATATTTTACCTACGAGGAGCTTAAAGATATCAAAAAGAAAGTGATTGCACAGCACTGCTCACAGAAGGACACGGCAGAGCTCCTC

AGAGGGCTCAGTCTGTGGAACCAAGCTGAGGAGCGACAGAAAGTTCTCAAGTACTCTGTGGATGAGAAGGCAGATACAG AAGCGGAAGTGTCAGAACAC

TCCACAGGTATAACCCATCTTCCTCCTGAGGTAATGCTGTCCATTTTCAGTTACCTTAATCCTCAAGAATTGTGTCGGTGTAGTCAAGTCAGTACTAAGT

GGTCTCAGCTGGCAAAAACAGGATCTTTGTGGAAACATCTTTACCCTGTTCATTGGGCAAGAG GTGACTGGTATAGTGGTCCTGCCACTGAACTTGATA

CTGAGCCTGATGAGGAATGGGTGAGAAATAGGAAAGATGAAAGTCGTGCTTTCCAGGAGTGGGATGAAGATGCCGATATAGATGAATCTG AAGAGTCTG

CAGAGGAATCGGTTGCTATCAGCATTGCACAAATGGAAAAACGTGTACTCCATGGCTTAATTCATAATGTTCTGCCATATGTTGGTACCTCTGTAAAAAC

TTTAGTGTTAGCGTACAGCTCTGCAGTCTCCAGCAAAATG GTTAGGCAGATTTTAGAGCTTTGTCCTAACCTGGAACATCTGGATCTTACCCAGACCGA

CATTTCTGATTCTGCATTTGACAG TTGGTCTTGGCTCGGTTGCTGCCAGAGTCTTCGGCATCTTGATCTGTCTGGATGTGAAAAAATCACAGACATGGC

TCTAGAGAAGATTTCTAGAGCTCTTGGAGTTCTGACATCTCATCAGAGTGGCTTTCTGAAAAGTGCAGGCAAGGCTGCTTCAACTCCATGGACAAGTAAA

GACATTACCATGCCATCCACCACGCAGTATGCCTGTTTGCACAATTTAACTGACAAAGGCATTGGTGAAGAAATAGACAACGAGCACTCTTGGACTGAAC

CTGTGTCTTCTGAAAGTTTGACTTCTCCTTATGTGTGGATGCTAGATGCTGAAGATTTGGCTGATATTGAAGATGCTGTAGAGTGGAGACACAGAAATGT

TGAGAGTCTCTGTGTGATGGAAACAGCCTCCAACTTTGGTTGTTCCTCATCTGGTTGTTACAGTAAGGACATTGTGGGATTAAGGACTAGTGTCTGTTGG

CAGCAGCATTGTGCTTCTCCAGCCTTTGCATATTGTGGTCATTCATTCTGTTGTACAGGGACAGCTTTAAGAACTATGACTACACTCCCAGCGACTTCTG

CAATGTGTAGAAAAGCATTAAGGACTACATTGCCCAGGGGGAAAGACTTAATTTATTTTGGGAGTGAAAAGTCTGACCAAGAGACTGGACGAGTACTTTT

GTTCCTCAGTCTGTCTGGATGTTACCAGATCACAGACCATGGTCTCAGGTGGGTGATCAGCCCTAGTTGTTAG
Translation
MAPFPDEVDVFTAPHWRMKQLVGRYCDK - UNI33122 - LSKTNFSNNNDFRALLQSLYATFKEFKMHEQIENEYIIGLLQQRSQTIYNVHSDNKLS

EMLSLFEKGLKNVK - UNI19604 - NEYEQLNYAKQLKERLEAFTRDFLPHMKEEEE VFQPMLMEYFTYEELKDIKKKVIAQHCSQKDTAELLRGL

SLWNQAEERQKVLKYSVDEKADTE EAEVSEHSTGITHLPPEVMLSIFSYLNPQELCRCSQVSTKWSQLAKTGSLWKHLYPVHWARG GDWYSGPATELD

TEPDEEWVRNRKDESRAFQEWDEDADIDESE EESAEESVAISIAQMEKRVLHGLIHNVLPYVGTSVKTLVLAYSSAVSSKM VRQILELCPNLEHLDLT

QTDISDSAFDS SWSWLGCCQSLRHLDLSGCEKITDMALEKISRALGVLTSHQSGFLKSAGKAASTPWTSKDITMPSTTQYACLHNLTDKGIGEEIDNEH

SWTEPVSSESLTSPYVWMLDAEDLADIEDAVEWRHRNVESLCVMETASNFGCSSSGCYSKDIVGLRTSVCWQQHCASPAFAYCGHSFCCTGTALRTMTTL

PATSAMCRKALRTTLPRGKDLIYFGSEKSDQETGRVLLFLSLSGCYQITDHGLRWVISPSC
Transcript ENSMUST00000119523
Sequence
GCCCCGCGGCGAGGGTGTCTATGGAGAGGCGGCGGCCGCGGCTGCTGAGGCGGACGCTGAGGCAGTGGCGATGGCGCCCTTCCCCGATGAAGTGGACGTC

TTCACCGCCCCGCACTGGCGGATGAAGCAGCTGGTGGGGCGCTACTGCGACAAG - UNI33122 - TCTTTATATGCTACTTTCAAGGAGTTTAAAAT

GCATGAACAAATTGAAAATGAATACATTATCGGTTTACTTCAGCAGCGCAGTCAGACCATATATAATGTACACTCTGACAATAAGCTCTCCGAGATGCTG

AGTCTCTTTGAAAAGGGGCTGAAGAATGTCAAG - UNI19604 - AATGAGTACGAACAGTTAAATTATGCAAAACAGCTGAAAGAGAGATTGGAGGC

TTTTACAAGAGATTTTCTTCCTCACATGAAAGAGGAAGAAGAG GTTTTTCAGCCCATGTTAATGGAATATTTTACCTACGAGGAGCTTAAAGATATCAA

AAAGAAAGTGATTGCACAGCACTGCTCACAGAAGGACACGGCAGAGCTCCTCAGAGGGCTCAGTCTGTGGAACCAAGCTGAGGAGCGACAGAAAGTTCTC

AAGTACTCTGTGGATGAGAAGGCAGATACAG AAGCGGAAGTGTCAGAACACTCCACAGGTATAACCCATCTTCCTCCTGAGGTAATGCTGTCCATTTTC

AGTTACCTTAATCCTCAAGAATTGTGTCGGTGTAGTCAAGTCAGTACTAAGTGGTCTCAGCTGGCAAAAACAGGATCTTTGTGGAAACATCTTTACCCTG

TTCATTGGGCAAGAG GTGACTGGTATAGTGGTCCTGCCACTGAACTTGATACTGAGCCTGATGAGGAATGGGTGAGAAATAGGAAAGATGAAAGTCGTG

CTTTCCAGGAGTGGGATGAAGATGCCGATATAGATGAATCTG AAGAGTCTGCAGAGGAATCGGTTGCTATCAGCATTGCACAAATGGAAAAACGTGTAC

TCCATGGCTTAATTCATAATGTTCTGCCATATGTTGGTACCTCTGTAAAAACTTTAGTGTTAGCGTACAGCTCTGCAGTCTCCAGCAAAATG GTTAGGC

AGATTTTAGAGCTTTGTCCTAACCTGGAACATCTGGATCTTACCCAGACCGACATTTCTGATTCTGCATTTGACAG TTGGTCTTGGCTCGGTTGCTGCC

AGAGTCTTCGGCATCTTGATCTGTCTGGATGTGAAAAAATCACAGACATGGCTCTAGAGAAGATTTCTAGAGCTCTTGGAGTTCTGACATCTCATCAGAG

TGGCTTTCTGAAAAGTGCAGGCAAGGCTGCTTCAACTCCATGGACAAGTAAAGACATTACCATGCCATCCACCACGCAGTATGCCTGTTTGCACAATTTA

ACTGACAAAGGCATTGGTGAAGAAATAGACAACGAGCACTCTTGGACTGAACCTGTGTCTTCTGAAAGTTTGACTTCTCCTTATGTGTGGATGCTAGATG

CTGAAGATTTGGCTGATATTGAAGATGCTGTAGAGTGGAGACACAGAAATGTTGAGAGTCTCTGTGTGATGGAAACAGCCTCCAACTTTGGTTGTTCCTC

ATCTGGTTGTTACAGTAAGGACATTGTGGGATTAAGGACTAGTGTCTGTTGGCAGCAGCATTGTGCTTCTCCAGCCTTTGCATATTGTGGTCATTCATTC

TGTTGTACAGGGACAGCTTTAAGAACTATGACTACACTCCCAGCGACTTCTGCAATGTGTAGAAAAGCATTAAGGACTACATTGCCCAGGGGGAAAGACT

TAATTTATTTTGGGAGTGAAAAGTCTGACCAAGAGACTGGACGAGTACTTTTGTTCCTCAGTCTGTCTGGATGTTACCAGATCACAGACCATGGTCTCAG

 GGCTCTGACTCTGGGAGGAGGGCTGCCTTACCTGGAGCACCTGAATCTCTCTGGCTGTCTGACTGTAACTGGTGCAGGGCTGCAGGATTTGGTCTCAGC

GTGTCCTTCCCTAAATGACGAATACTTTTACTACTGTGACAACATTAACG GTCCTCATGCTGACACCGCCAGTGGATGCCAGAATTTGCAGTGTGGTTT

TCGAGCCTGCTGCCGCTCTGGCGAATGACCCCTGACTTCTGACCTTTGTCTACTTCATTTAGCTGAGCAGGCTTCCTTTCATGCACTTTACTTATAGCAC

ATTTCTTGTGTTAACAACCCATTTTGGGTGTGTCTTGTTTGGCCCCATTTCTTACAGTCTCAGAAATTTAATTTAGCAGTGAACTGTACAATGTTGTTTA

CCCTTGCAAAATATATTTTTGTTTTAGAAAAGGTTTAGGATTTTTTGTTAGGGTGAGAACAGTCTTTCTGGTTTCTTTTCAATGAAATGCTTTAAAAAAT

ATCACTAATACCATGCTATTTAAAGTTTTTCTAGATTATTTGCATTTTAGTCAATGGGGGTTATTGGTTCTCTTATGTGTAAACACTGTACCAAGTTTTG

CAGATTCTTTCAAATCCACATTTCTGAAGTTTTATTTTCAAAGACTGAACATTTTAGAAAGGAATCTCTTTTCCCCTAACGTTTTCTTTATTTGAACAAT

TCTGAGGGGCCAATTCAAACACACTTAGAAGCGAGATTCTTTAAGATTATAGGATAAATTGGTCTCTTGGTGCAGCAGTCTGTTGTTTGCTGTAGACACC

AGCTTCCACTGCTGTCCCTAAACTGTTGAATTCTAGAAGGATTTTTAAAAATTCCACAATTGTTTGAAGAAATGTATAAATAAAATCTACTTTGAGAACT

TTACCAAGCAA
Translation
MAPFPDEVDVFTAPHWRMKQLVGRYCDK - UNI33122 - SLYATFKEFKMHEQIENEYIIGLLQQRSQTIYNVHSDNKLSEMLSLFEKGLKNVK - 

UNI19604 - NEYEQLNYAKQLKERLEAFTRDFLPHMKEEEE VFQPMLMEYFTYEELKDIKKKVIAQHCSQKDTAELLRGLSLWNQAEERQKVLKYSV

DEKADTE EAEVSEHSTGITHLPPEVMLSIFSYLNPQELCRCSQVSTKWSQLAKTGSLWKHLYPVHWARG GDWYSGPATELDTEPDEEWVRNRKDESRA

FQEWDEDADIDESE EESAEESVAISIAQMEKRVLHGLIHNVLPYVGTSVKTLVLAYSSAVSSKM VRQILELCPNLEHLDLTQTDISDSAFDS SWSWL

GCCQSLRHLDLSGCEKITDMALEKISRALGVLTSHQSGFLKSAGKAASTPWTSKDITMPSTTQYACLHNLTDKGIGEEIDNEHSWTEPVSSESLTSPYVW

MLDAEDLADIEDAVEWRHRNVESLCVMETASNFGCSSSGCYSKDIVGLRTSVCWQQHCASPAFAYCGHSFCCTGTALRTMTTLPATSAMCRKALRTTLPR

GKDLIYFGSEKSDQETGRVLLFLSLSGCYQITDHGLR RALTLGGGLPYLEHLNLSGCLTVTGAGLQDLVSACPSLNDEYFYYCDNING GPHADTASGC

QNLQCGFRACCRSGE
Transcript ENSMUST00000047857
Sequence
CCGCGGCGAGGGTGTCTATGGAGAGGCGGCGGCCGCGGCTGCTGAGGCGGACGCTGAGGCAGTGGCGATGGCGCCCTTCCCCGATGAAGTGGACGTCTTC

ACCGCCCCGCACTGGCGGATGAAGCAGCTGGTGGGGCGCTACTGCGACAAG - UNI33122 - CTTTCTAAAACCAACTTTTCCAACAACAATGACTT

CCGTGCTCTTCTCCAGTCTTTATATGCTACTTTCAAGGAGTTTAAAATGCATGAACAAATTGAAAATGAATACATTATCGGTTTACTTCAGCAGCGCAGT

CAGACCATATATAATGTACACTCTGACAATAAGCTCTCCGAGATGCTGAGTCTCTTTGAAAAGGGGCTGAAGAATGTCAAG - UNI19604 - AATGA

GTACGAACAGTTAAATTATGCAAAACAGCTGAAAGAGAGATTGGAGGCTTTTACAAGAGATTTTCTTCCTCACATGAAAGAGGAAGAAGAG GTTTTTCA

GCCCATGTTAATGGAATATTTTACCTACGAGGAGCTTAAAGATATCAAAAAGAAAGTGATTGCACAGCACTGCTCACAGAAGGACACGGCAGAGCTCCTC

AGAGGGCTCAGTCTGTGGAACCAAGCTGAGGAGCGACAGAAAGTTCTCAAGTACTCTGTGGATGAGAAGGCAGATACAG AAGCGGAAGTGTCAGAACAC

TCCACAGGTATAACCCATCTTCCTCCTGAGGTAATGCTGTCCATTTTCAGTTACCTTAATCCTCAAGAATTGTGTCGGTGTAGTCAAGTCAGTACTAAGT

GGTCTCAGCTGGCAAAAACAGGATCTTTGTGGAAACATCTTTACCCTGTTCATTGGGCAAGAG GTGACTGGTATAGTGGTCCTGCCACTGAACTTGATA

CTGAGCCTGATGAGGAATGGGTGAGAAATAGGAAAGATGAAAGTCGTGCTTTCCAGGAGTGGGATGAAGATGCCGATATAGATGAATCTG AAGAGTCTG

CAGAGGAATCGGTTGCTATCAGCATTGCACAAATGGAAAAACGTGTACTCCATGGCTTAATTCATAATGTTCTGCCATATGTTGGTACCTCTGTAAAAAC

TTTAGTGTTAGCGTACAGCTCTGCAGTCTCCAGCAAAATG GTTAGGCAGATTTTAGAGCTTTGTCCTAACCTGGAACATCTGGATCTTACCCAGACCGA

CATTTCTGATTCTGCATTTGACAG TTGGTCTTGGCTCGGTTGCTGCCAGAGTCTTCGGCATCTTGATCTGTCTGGATGTGAAAAAATCACAGACATGGC

TCTAGAGAAGATTTCTAGAGCTCTTGGAGTTCTGACATCTCATCAGAGTGGCTTTCTGAAAAGTGCAGGCAAGGCTGCTTCAACTCCATGGACAAGTAAA

GACATTACCATGCCATCCACCACGCAGTATGCCTGTTTGCACAATTTAACTGACAAAGGCATTGGTGAAGAAATAGACAACGAGCACTCTTGGACTGAAC

CTGTGTCTTCTGAAAGTTTGACTTCTCCTTATGTGTGGATGCTAGATGCTGAAGATTTGGCTGATATTGAAGATGCTGTAGAGTGGAGACACAGAAATGT

TGAGAGTCTCTGTGTGATGGAAACAGCCTCCAACTTTGGTTGTTCCTCATCTGGTTGTTACAGTAAGGACATTGTGGGATTAAGGACTAGTGTCTGTTGG

CAGCAGCATTGTGCTTCTCCAGCCTTTGCATATTGTGGTCATTCATTCTGTTGTACAGGGACAGCTTTAAGAACTATGACTACACTCCCAGCGACTTCTG

CAATGTGTAGAAAAGCATTAAGGACTACATTGCCCAGGGGGAAAGACTTAATTTATTTTGGGAGTGAAAAGTCTGACCAAGAGACTGGACGAGTACTTTT

GTTCCTCAGTCTGTCTGGATGTTACCAGATCACAGACCATGGTCTCAG GGCTCTGACTCTGGGAGGAGGGCTGCCTTACCTGGAGCACCTGAATCTCTC

TGGCTGTCTGACTGTAACTGGTGCAGGGCTGCAGGATTTGGTCTCAGCGTGTCCTTCCCTAAATGACGAATACTTTTACTACTGTGACAACATTAACG G

TCCTCATGCTGACACCGCCAGTGGATGCCAGAATTTGCAGTGTGGTTTTCGAGCCTGCTGCCGCTCTGGCGAATGACCCCTGACTTCTGACCTTTGTCTA

CTTCATTTAGCTGAGCAGGCTTCCTTTCATGCACTTTACTTATAGCACATTTCTTGTGTTAACAACCCATTTTGGGTGTGTCTTGTTTGGCCCCATTTCT

TACAGTCTCAGAAATTTAATTTAGCAGTGAACTGTACAATGTTGTTTACCCTTGCAAAATATATTTTTGTTTTAGAAAAGGTTTAGGATTTTTTGTTAGG

GTGAGAACAGTCTTTCTGGTTTCTTTTCAATGAAATGCTTTAAAAAATATCACTAATACCATGCTATTTAAAGTTTTTCTAGATTATTTGCATTTTAGTC

AATGGGGGTTATTGGTTCTCTTATGTGTAAACACTGTACCAAGTTTTGCAGATTCTTTCAAATCCACATTTCTGAAGTTTTATTTTCAAAGACTGAACAT

TTTAGAAAGGAATCTCTTTTCCCCTAACGTTTTCTTTATTTGAACAATTCTGAGGGGCCAATTCAAACACACTTAGAAGCGAGATTCTTTAAGATTATAG

GATAAATTGGTCTCTTGGTGCAGCAGTCTGTTGTTTGCTGTAGACACCAGCTTCCACTGCTGTCCCTAAACTGTTGAATTCTAGAAGGATTTTTAAAAAT

TCCACAATTGTTTGAAGAAATGTATAAATAAAATCTACTTTGAGAACTTTACCAAGC
Translation
MAPFPDEVDVFTAPHWRMKQLVGRYCDK - UNI33122 - LSKTNFSNNNDFRALLQSLYATFKEFKMHEQIENEYIIGLLQQRSQTIYNVHSDNKLS

EMLSLFEKGLKNVK - UNI19604 - NEYEQLNYAKQLKERLEAFTRDFLPHMKEEEE VFQPMLMEYFTYEELKDIKKKVIAQHCSQKDTAELLRGL

SLWNQAEERQKVLKYSVDEKADTE EAEVSEHSTGITHLPPEVMLSIFSYLNPQELCRCSQVSTKWSQLAKTGSLWKHLYPVHWARG GDWYSGPATELD

TEPDEEWVRNRKDESRAFQEWDEDADIDESE EESAEESVAISIAQMEKRVLHGLIHNVLPYVGTSVKTLVLAYSSAVSSKM VRQILELCPNLEHLDLT

QTDISDSAFDS SWSWLGCCQSLRHLDLSGCEKITDMALEKISRALGVLTSHQSGFLKSAGKAASTPWTSKDITMPSTTQYACLHNLTDKGIGEEIDNEH

SWTEPVSSESLTSPYVWMLDAEDLADIEDAVEWRHRNVESLCVMETASNFGCSSSGCYSKDIVGLRTSVCWQQHCASPAFAYCGHSFCCTGTALRTMTTL

PATSAMCRKALRTTLPRGKDLIYFGSEKSDQETGRVLLFLSLSGCYQITDHGLR RALTLGGGLPYLEHLNLSGCLTVTGAGLQDLVSACPSLNDEYFYY

CDNING GPHADTASGCQNLQCGFRACCRSGE
Transcript ENSMUST00000114047
Sequence
ATGAGAAACAACCAGGAGTTAAAATACGAAATAAAATGGAAGCACCTTGACTGCAGTGTCGTCGAG - UNI33122 - CTTTCTAAAACCAACTTTTC

CAACAACAATGACTTCCGTGCTCTTCTCCAGTCTTTATATGCTACTTTCAAGGAGTTTAAAATGCATGAACAAATTGAAAATGAATACATTATCGGTTTA

CTTCAGCAGCGCAGTCAGACCATATATAATGTACACTCTGACAATAAGCTCTCCGAGATGCTGAGTCTCTTTGAAAAGGGGCTGAAGAATGTCAAG - U

NI19604 - AATGAGTACGAACAGTTAAATTATGCAAAACAGCTGAAAGAGAGATTGGAGGCTTTTACAAGAGATTTTCTTCCTCACATGAAAGAGGAA

GAAGAG GTTTTTCAGCCCATGTTAATGGAATATTTTACCTACGAGGAGCTTAAAGATATCAAAAAGAAAGTGATTGCACAGCACTGCTCACAGAAGGAC

ACGGCAGAGCTCCTCAGAGGGCTCAGTCTGTGGAACCAAGCTGAGGAGCGACAGAAAGTTCTCAAGTACTCTGTGGATGAGAAGGCAGATACAG AAGCG

GAAGTGTCAGAACACTCCACAGGTATAACCCATCTTCCTCCTGAGGTAATGCTGTCCATTTTCAGTTACCTTAATCCTCAAGAATTGTGTCGGTGTAGTC

AAGTCAGTACTAAGTGGTCTCAGCTGGCAAAAACAGGATCTTTGTGGAAACATCTTTACCCTGTTCATTGGGCAAGAG GTGACTGGTATAGTGGTCCTG

CCACTGAACTTGATACTGAGCCTGATGAGGAATGGGTGAGAAATAGGAAAGATGAAAGTCGTGCTTTCCAGGAGTGGGATGAAGATGCCGATATAGATGA

ATCTG AAGAGTCTGCAGAGGAATCGGTTGCTATCAGCATTGCACAAATGGAAAAACGTGTACTCCATGGCTTAATTCATAATGTTCTGCCATATGTTGG

TACCTCTGTAAAAACTTTAGTGTTAGCGTACAGCTCTGCAGTCTCCAGCAAAATG GTTAGGCAGATTTTAGAGCTTTGTCCTAACCTGGAACATCTGGA

TCTTACCCAGACCGACATTTCTGATTCTGCATTTGACAG TTGGTCTTGGCTCGGTTGCTGCCAGAGTCTTCGGCATCTTGATCTGTCTGGATGTGAAAA

AATCACAGACATGGCTCTAGAGAAGATTTCTAGAGCTCTTGGAGTTCTGACATCTCATCAGAGTGGCTTTCTGAAAAGTGCAGGCAAGGCTGCTTCAACT

CCATGGACAAGTAAAGACATTACCATGCCATCCACCACGCAGTATGCCTGTTTGCACAATTTAACTGACAAAGGCATTGGTGAAGAAATAGACAACGAGC

ACTCTTGGACTGAACCTGTGTCTTCTGAAAGTTTGACTTCTCCTTATGTGTGGATGCTAGATGCTGAAGATTTGGCTGATATTGAAGATGCTGTAGAGTG

GAGACACAGAAATGTTGAGAGTCTCTGTGTGATGGAAACAGCCTCCAACTTTGGTTGTTCCTCATCTGGTTGTTACAGTAAGGACATTGTGGGATTAAGG

ACTAGTGTCTGTTGGCAGCAGCATTGTGCTTCTCCAGCCTTTGCATATTGTGGTCATTCATTCTGTTGTACAGGGACAGCTTTAAGAACTATGACTACAC

TCCCAGCGACTTCTGCAATGTGTAGAAAAGCATTAAGGACTACATTGCCCAGGGGGAAAGACTTAATTTATTTTGGGAGTGAAAAGTCTGACCAAGAGAC

TGGACGAGTACTTTTGTTCCTCAGTCTGTCTGGATGTTACCAGATCACAGACCATGGTCTCAG GGCTCTGACTCTGGGAGGAGGGCTGCCTTACCTGGA

GCACCTGAATCTCTCTGGCTGTCTGACTGTAACTGGTGCAGGGCTGCAGGATTTGGTCTCAGCGTGTCCTTCCCTAAATGACGAATACTTTTACTACTGT

GACAACATTAACG GTCCTCATGCTGACACCGCCAGTGGATGCCAGAATTTGCAGTGTGGTTTTCGAGCCTGCTGCCGCTCTGGCGAATGACCCCTGACT

TCTGACCTTTGTCTACTTCATTTAGCTGAGCAGGCTTCCTTTCATGCACTTTACTTATAGCACATTTCTTGTGTTAACAACCCATTTTGGGTGTGTCTTG

TTTGGCCCCATTTCTTACAGTCTCAGAAATTTAATTTAGCAGTGAACTGTACAATGTTGTTTACCCTTGCAAAATATATTTTTGTTTTAGAAAAGGTTTA

GGATTTTTTGTTAGGGTGAGAACAGTCTTTCTGGTTTCTTTTCAATGAAATGCTTTAAAAAATATCACTAATACCATGCTATTTAAAGTTTTTCTAGATT

ATTTGCATTTTAGTCAATGGGGGTTATTGGTTCTCTTATGTGTAAACACTGTACCAAGTTTTGCAGATTCTTTCAAATCCACATTTCTGAAGTTTTATTT

TCAAAGACTGAACATTTTAGAAAGGAATCTCTTTTCCCCTAACGTTTTCTTTATTTGAACAATTCTGAGGGGCCAATTCAAACACACTTAGAAGCGAGAT

TCTTTAAGATTATAGGATAAATTGGTCTCTTGGTGCAGCAGTCTGTTGTTTGCTGTAGACACCAGCTTCCACTGCTGTCCCTAAACTGTTGAATTCTAGA

AGGATTTTTAAAAATTCCACAATTGTTTGAAGAAATGTATAAATAAAATCTACTTTGAGAACTTTACCAAGC
Translation
MRNNQELKYEIKWKHLDCSVVE - UNI33122 - LSKTNFSNNNDFRALLQSLYATFKEFKMHEQIENEYIIGLLQQRSQTIYNVHSDNKLSEMLSLF

EKGLKNVK - UNI19604 - NEYEQLNYAKQLKERLEAFTRDFLPHMKEEEE VFQPMLMEYFTYEELKDIKKKVIAQHCSQKDTAELLRGLSLWNQA

EERQKVLKYSVDEKADTE EAEVSEHSTGITHLPPEVMLSIFSYLNPQELCRCSQVSTKWSQLAKTGSLWKHLYPVHWARG GDWYSGPATELDTEPDEE

WVRNRKDESRAFQEWDEDADIDESE EESAEESVAISIAQMEKRVLHGLIHNVLPYVGTSVKTLVLAYSSAVSSKM VRQILELCPNLEHLDLTQTDISD

SAFDS SWSWLGCCQSLRHLDLSGCEKITDMALEKISRALGVLTSHQSGFLKSAGKAASTPWTSKDITMPSTTQYACLHNLTDKGIGEEIDNEHSWTEPV

SSESLTSPYVWMLDAEDLADIEDAVEWRHRNVESLCVMETASNFGCSSSGCYSKDIVGLRTSVCWQQHCASPAFAYCGHSFCCTGTALRTMTTLPATSAM

CRKALRTTLPRGKDLIYFGSEKSDQETGRVLLFLSLSGCYQITDHGLR RALTLGGGLPYLEHLNLSGCLTVTGAGLQDLVSACPSLNDEYFYYCDNING

 GPHADTASGCQNLQCGFRACCRSGE

For any suggestions or comments, please send an email to unitrap@crg.es