Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000039782 (Cpeb2)
Chromosomal location
Chr 5: 43625195 - 43680963 (+)
Description
cytoplasmic polyadenylation element binding protein 2 Gene [Source:MGI (curated);Acc:Cpeb2-001]
RefSeq_dna
NM_175937 
RefSeq_peptide
NP_787951.1 
UniGene
Mm.398905 Mm.408452 
MGI
MGI:2442640 
Uniprot/SWISSPROT
Q812E0 
Human Ortholog
ENSG00000137449 (CPEB2)
Omim not available
UniTrap UNI30279
Vector Insertion
Chr 5: 43629656 - 43635824
Public Clones D047E08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114065
Sequence
AGCAGCAGCTGAGCAGCCAGAAGAGGAAAGAGTTGAGCCCGCCACACCGTCCCCACCCTCC GGCGGCGGCTTCGGCGGCCCGTTCTCTGCTCCCACGGT

GCCCGCGCCGCCCGCCATGAATTTACCTCAACAGCAGCCGCCGGCGGCGGCGCCGCAGCAGCCGCAGAGCCGGAGGTCACCCGTCAGCCCGCAGCTGCAG

CAGCAGCACCAGGCTGCCGCAGCCGCCTTCCTGCAGCAGAGGAACTCGTACAACCACCACCAG CCTCTTCTGAAACAGTCTCCTTGGAGCAACCATCAG

AACAGCGGTTGGGGCACTGCGAGCATGTCCTGGGGAGCAATGCACGGCAGAGATCACCGCAGGAGCGGCAACATGGGGATCCCAGGGACTATGAATCAGA

TATCTCCGCTGAAGAAGCCGTTCTCGGGTAATGTTATAGCACCACCGAAATTCACTCGCTCTACTCCATCACTGACTCCAAAATCTTGGATTGAAGATAA

TGTGTTCAGGACAGACAACAATAGTAACACACTCTTACCCTTACAG GTGAGATCTAGTTTGCAGTTGCCAGCTTGGGGCTCAGATTCACTCCAAGATAG

TTGGTGCACTGCAGCCGGAACATCCAGAATAGACCAG - UNI30279 - GATCGAAGTAGAATGTATGATAGCTTGAATATGCACTCTCTGGAAAATT

CCCTTATTGATATCATGAGAGCAGAGCACGATCCTCTCAAGG GTCGTCTGAGCTATCCACATCCAGGAACCGACAATCTGTTAATGTTAAATG GTCGC

TCTTCCCTATTTCCAATAGATGATAGCTTGTTGGATGATGGTCACAGTGATCAAGTTGGTGTTTTAAATTCACCAACATGTTATTCAGCTCATCAAAATG

GAGAACGAATTGAACGCTTCTCTCGAAAAGTTTTTGTTGGTGGGCTTCCTCCGGATATTGATGAAG ATGAGATCACTGCCAGCTTCCGAAGATTTGGAC

CTTTGGTAGTAGATTGGCCCCACAAAGCAGAAAGTAAATCCTATTTTCCACCAAAAG GCTATGCATTCCTCCTCTTTCAAGAAGAGAGCTCAGTCCAGG

CACTCATTGACGCTTGCATTGAAGAAGATGGAAAGCTCTACTTGTGTGTTTCCAGCCCTACTATCAAAGACAAACCT GTTCAAATCCGTCCTTGGAATT

TAAGTGATAGTGATTTCGTCATGGATGGTTCTCAGCCTTTGGATCCCCGAAAAACAATTTTTGTTGGAGGTGTTCCTAGGCCACTAAGGGCTG TGGAAC

TTGCTATGATCATGGACCGGCTGTATGGTGGTGTGTGTTACGCAGGAATTGATACAGATCCAGAACTCAAATACCCAAAAGGTGCTGGGCGAGTCGCTTT

CTCCAATCAGCAGAGCTACATTGCTGCCATCAGTGCTCGATTTGTTCAGCTTCAGCACGGTGACATTGATAAACGT GTGGAGGTGAAGCCATATGTGCT

AGATGACCAGATGTGTGACGAGTGCCAGGGTGCACGCTGTGGTGGGAAATTTGCCCCCTTTTTCTGTGCCAATGTCACCTGCCTGCAGTATTACTGTGAG

TTTTGTTGGGCAAATATCCACTCTCGTGCAGGACGCGAGTTCCATAAGCCATTGGTGAAGGAAGGTGCTGATCGCCCACGTCAGATCCACTTCCGCTGGA

ACTAAGTATAGCCAACTGGCCTCGGTCTAGGAAGGAAGGAAAGGGTGCATGTGGCTTACTGTGCTGAAGACACTGACGTGCAGAAGAAATAAGTGCATTC

TCCTGCTGCTCACCCAGCTCTCGATACATGCATCGTTATCAGCAGCCAAAACACTACAAGCCTCTTGTTTTTCACCAAAACCCTACATCTCAGGCTTACT

AATTTTTGTGATATTTTCATGTTAAAATAAAATGTTTTTTTGTATTTTCTCCAAGTTATTTTTATATGTAAAGTTAAAATTAGATATGAGAATGTTTTGC

GTAGGGGCAACACAGTCTGCTGCTATATAGTGGGTGAAGCGTGCACTTATTTCTTAACATGGGTTTTTAACTTCAAGATCTGCCCCAGTACTTTACCAAA

GGTAGCAAAATAATAGTGAAGATGGAATATGTCTGCTACAAATGCTTATTTTTATTGTTGCTGTTTTCAGTGTGTACATAAACTAAAAATTAGGGTTGAT

TTTGTTGCTCTCCATTTTGACTTGCAAGAAATAATACCTCAAGATAATCTGATTTATTAGCTATTTTTAAACATTTTTAATCACAAGCTGTATTAGCTTT

GCTGCTATATAGGTGTTATGTGTAAATGTCACCTATTAATACGGGATTGAAAACGTTAGAGACACACTGCATTGCGGATGAAATGCAGGCAGCACAATAT

GGCCGGAACTGCCATAGTTTAGAATGTGAAACAATGCATGTTTACTTACCTGTGTCCACCATATGCATGCACTCGGACATTAACTAACGAGGTGAGGTAT

TGCAGATGTTCAAAAAGCTCTCTTGAATCTAGGTAGCATGAACAAATTAGAAAATTTGTTTCTTTACAAAAAAGCAAACTTGCATGCATTATTGTGACTT

CAAGTTAAAAATGTTGTCCTACATGTGTACAATATGCAAATTAGTTTTAGATTAGAGAGTGCAGCCATTTTGTGATCTGGTCAGTAGTGGAATTCGATTT

TATGCAGACTGGATGTAATATTTGTAATCCCTGTGCAATTTTGTGATGTGCGGTTCTAATTCATGTGCAGTGATATAGTATAGATAAAAGATTGAATAAA

AGAAAAACACAGGAATTTTAAAGAAAGTTGATTTTAGCCCCTTTGATAGTTCATGGTTAAGACATCCTTTAAAAACCAAAGATGGCCAGCACACTGCTAA

CCAGTCACCGAATGTGAGACCCATGAAAAGACCATACTTTAAAAGAGGATTTTATAGAAGAACACAGAACTTTAGTGAAGTCAAAATGGAGATGGGAAAA

TATAATAGATGGCTAGTTGCATAAAATTTACCTTTGATGGTGAAATCTGGCTTAAATTTGCTTACATGTTTGACCTATGTCTATGGGGTCTTCTGTCTAA

ACTGGGGTCACTGTTGCATGGAGCATTGTTATTCTTAATGGTTAAGAATTGCTTTTTTAAAACTTTGATGAAGGAATTTCAGTAATGACTTTGCTTGCAT

CTTTTCTTTTTTCTTTATTGAGGGAGTTGCGTGGAAACATGCACGGTTCTGACCTAGAACATCGTTCGTTCGTGGTGGTTTTCCTCTTTAGAGCATCCTA

ACAGCAGCTAGCCGCTGTGTTAATAATGTAGGAGTTACCCTGCAGTCTAAGCAAAGCACCCCACATGGTAAATGTTGGTTTTTGTTGTTGTTGTTATTGT

TGTTTATTTTTTTAAATGCAGAACTAAGATTTTTGACTCTAAAGAGAGAAAATTGCAAGGGTATGGCCCGTGCAGCAAACCCTTGGGACAATCCTTCACA

TGAGCAAAGTACTGATCTCAACATTGGTTGTCGATGGTATGCTTTTTTGTACTGTAAAAATGCGTGGTTCATGTCTAACTCTGCTGTTTTATTGTGGTTG

TGGCTCAAGTTTTTAGTGTTTGACGTTGATGCTGTTTTCAGAGGAGCTCTTTACTAATTTATTTGTCCGTATCCCAACCTCTTCCTCCCCGTGGCCCTCC

AGAGTTTCTGGAGCATTCTTTTCACCCTCGCCCTGCCAACCCTTGATCCATTTTGACATTTGTTGTGCACTATTTTTATATCTCTGTGAGCGATTTTTCC

AGCAGTCAGCTATTTTATGGCATACTTTTTTTCACTGATGACATCTCCTTTGCTATACCTCAATTTTTGGAATTTAGAAAAGAAATCAGTAGTTTTGCAA

TGTTAATTATTTAGATATTTAATTTCGCAGATTTTTAAACTTTATTTTCATAATTTCTGCTTAATGTTTAAAATTGAAGAGCCTTTTCATGTATTAAATA

ATGAACTCTAAAATAAATTATATAATAAAATAATTGGAGATGCTGAAAATTATTTTCCCTTCTTAAACGGAAGTAAATATTTGAAATGAAGGGGAAATGA

AAGAGAAACACCTTCTCCTACCAGGGTGAACGTGACAGAAATGCTGGTTTGTGTCACCTTCGTTCCTGTTAGGACAAAGCTCATTGGTCTAATACTGTGT

CCCTCCCTGCCTCTCCCCTACCTCTGATTTGTTTTGTTTTCTGTTTGTTTGGGGATTATTTTTCCTTTTATGTACTACATTTTTATTTTCTAACCGTTAA

ACACTGTATTTGAGTTTTTTTAATTTACAGATCATATTTATTTTACTATTTTTGTAGAAAATTATTAATTTTGATTGTATTTTTGTATTTTCAAAGCTTC

TTCATTTGTGTTCCCTAAATGTTCATATTGCTGCCCAAAAGTATGAATGACTGTGGAGGAAAAAGTACTTTAAAAATCCACACTTTTTGTTAAGAAGGAA

ACATTTAGCATTTATATATTTGTGTATGGAAAACACTTGATATTTTATCCCTGTTGCATCTGGCTGCACGAGCCTCTCCTCAAAGATGCCACAAAACTTG

AATATAACACATTTTGGAAGGCTGACTAACCTCGATTCTGTGTTGTGATGTGCAATACTGTTTCTAATGTTTGTATAAAGATACAGTGTAAACCTTTTTA

ATGCAAATTTATTTTTTTCATTGCATATTTTGCAGACTTTATCCACAGTGTCATTTTTTACTGTCAGAAAAGATGCCCCTTTTGTCATTGCAACTATTTT

TTAAACCCAGAAATCTTTGTACTGATGTAAATGATTGTAGTTATTTTGGATAGTGTTTTGCTAACAAAAGGAGAGACTTTTTTCATGCATATTTCTATTT

TGTTTTTTTGGGTTTTATTTTATTTTAATAGTAGTAAAATACTTGGAATAATTTTTCATATTCTTGTCATTAATATTATTTTGTATTTTTATGTGAAAAT

ATATAATTTTATGACACTAATTGCTAAAGTTTATTTTATGTTGAATTATTTTTGGAGCTGAAATCTTTGTAATATTAAAGCAACTAGTTTCTAATTCCCA

GTTTCTGTATAGAATCGCACAAGTGGTTTATGGAGTGTTTGGATTGTAACTATAAATGGTTCTTTGATATGCAAATTAATATTTTCAGTTGATTTTATTT

TATATTCCTAATGGGGTGTTAAAGCCGTTTTTTATTTTTTTCTAAATAAAAAGAGAACCCATGCTTTTATGGACACTAGGTAAAACGCCTTCAGCTTAAA

ATTTTTGTTAAATAATTTAGTTTATTTTATTGTTATCTTCCAGGTGTCTAAATCTCCAGTCTGTCTGTTGTACTGGTAATTTAACTCTGTAATGGAATAG

TTTGCTGCCAACTATTTATATTAAGTAATTTTTAAATATTTGTAATATTGTTGACTGACTAATAAACTATTAAGTTATTGGCA
Translation
 MNLPQQQPPAAAPQQPQSRRSPVSPQLQQQHQAAAAAFLQQRNSYNHHQ PLLKQSPWSNHQNSGWGTASMSWGAMHGRDHRRSGNMGIPGTMNQISPL

KKPFSGNVIAPPKFTRSTPSLTPKSWIEDNVFRTDNNSNTLLPLQ VRSSLQLPAWGSDSLQDSWCTAAGTSRIDQ - UNI30279 - DRSRMYDSLN

MHSLENSLIDIMRAEHDPLKG GRLSYPHPGTDNLLMLNG GRSSLFPIDDSLLDDGHSDQVGVLNSPTCYSAHQNGERIERFSRKVFVGGLPPDIDED 

DEITASFRRFGPLVVDWPHKAESKSYFPPKG GYAFLLFQEESSVQALIDACIEEDGKLYLCVSSPTIKDKP VQIRPWNLSDSDFVMDGSQPLDPRKTI

FVGGVPRPLRAV VELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKR VEVKPYVLDDQMCDECQGARCGGKF

APFFCANVTCLQYYCEFCWANIHSRAGREFHKPLVKEGADRPRQIHFRWN
Transcript ENSMUST00000114066
Sequence
AGCAGCAGCTGAGCAGCCAGAAGAGGAAAGAGTTGAGCCCGCCACACCGTCCCCACCCTCC GGCGGCGGCTTCGGCGGCCCGTTCTCTGCTCCCACGGT

GCCCGCGCCGCCCGCCATGAATTTACCTCAACAGCAGCCGCCGGCGGCGGCGCCGCAGCAGCCGCAGAGCCGGAGGTCACCCGTCAGCCCGCAGCTGCAG

CAGCAGCACCAGGCTGCCGCAGCCGCCTTCCTGCAGCAGAGGAACTCGTACAACCACCACCAG CCTCTTCTGAAACAGTCTCCTTGGAGCAACCATCAG

AACAGCGGTTGGGGCACTGCGAGCATGTCCTGGGGAGCAATGCACGGCAGAGATCACCGCAGGAGCGGCAACATGGGGATCCCAGGGACTATGAATCAGA

TATCTCCGCTGAAGAAGCCGTTCTCGGGTAATGTTATAGCACCACCGAAATTCACTCGCTCTACTCCATCACTGACTCCAAAATCTTGGATTGAAGATAA

TGTGTTCAGGACAGACAACAATAGTAACACACTCTTACCCTTACAG - UNI30279 - GATCGAAGTAGAATGTATGATAGCTTGAATATGCACTCTC

TGGAAAATTCCCTTATTGATATCATGAGAGCAGAGCACGATCCTCTCAAGG GTCGTCTGAGCTATCCACATCCAGGAACCGACAATCTGTTAATGTTAA

ATG CCCACATAGCTTTTCGTGTCACGGATATTTGGATGTGTGGGCTTGGTTTTAGTTCTAACATTTTACAATTTGTCCTTTGTTTACATGCAGCAAGGA

GTTATGGGCGAAGACGAG GTCGCTCTTCCCTATTTCCAATAGATGATAGCTTGTTGGATGATGGTCACAGTGATCAAGTTGGTGTTTTAAATTCACCAA

CATGTTATTCAGCTCATCAAAATGGAGAACGAATTGAACGCTTCTCTCGAAAAGTTTTTGTTGGTGGGCTTCCTCCGGATATTGATGAAG ATGAGATCA

CTGCCAGCTTCCGAAGATTTGGACCTTTGGTAGTAGATTGGCCCCACAAAGCAGAAAGTAAATCCTATTTTCCACCAAAAG GCTATGCATTCCTCCTCT

TTCAAGAAGAGAGCTCAGTCCAGGCACTCATTGACGCTTGCATTGAAGAAGATGGAAAGCTCTACTTGTGTGTTTCCAGCCCTACTATCAAAGACAAACC

T GTTCAAATCCGTCCTTGGAATTTAAGTGATAGTGATTTCGTCATGGATGGTTCTCAGCCTTTGGATCCCCGAAAAACAATTTTTGTTGGAGGTGTTCC

TAGGCCACTAAGGGCTG TGGAACTTGCTATGATCATGGACCGGCTGTATGGTGGTGTGTGTTACGCAGGAATTGATACAGATCCAGAACTCAAATACCC

AAAAGGTGCTGGGCGAGTCGCTTTCTCCAATCAGCAGAGCTACATTGCTGCCATCAGTGCTCGATTTGTTCAGCTTCAGCACGGTGACATTGATAAACGT

 GTGGAGGTGAAGCCATATGTGCTAGATGACCAGATGTGTGACGAGTGCCAGGGTGCACGCTGTGGTGGGAAATTTGCCCCCTTTTTCTGTGCCAATGTC

ACCTGCCTGCAGTATTACTGTGAGTTTTGTTGGGCAAATATCCACTCTCGTGCAGGACGCGAGTTCCATAAGCCATTGGTGAAGGAAGGTGCTGATCGCC

CACGTCAGATCCACTTCCGCTGGAACTAAGTATAGCCAACTGGCCTCGGTCTAGGAAGGAAGGAAAGGGTGCATGTGGCTTACTGTGCTGAAGACACTGA

CGTGCAGAAGAAATAAGTGCATTCTCCTGCTGCTCACCCAGCTCTCGATACATGCATCGTTATCAGCAGCCAAAACACTACAAGCCTCTTGTTTTTCACC

AAAACCCTACATCTCAGGCTTACTAATTTTTGTGATATTTTCATGTTAAAATAAAATGTTTTTTTGTATTTTCTCCAAGTTATTTTTATATGTAAAGTTA

AAATTAGATATGAGAATGTTTTGCGTAGGGGCAACACAGTCTGCTGCTATATAGTGGGTGAAGCGTGCACTTATTTCTTAACATGGGTTTTTAACTTCAA

GATCTGCCCCAGTACTTTACCAAAGGTAGCAAAATAATAGTGAAGATGGAATATGTCTGCTACAAATGCTTATTTTTATTGTTGCTGTTTTCAGTGTGTA

CATAAACTAAAAATTAGGGTTGATTTTGTTGCTCTCCATTTTGACTTGCAAGAAATAATACCTCAAGATAATCTGATTTATTAGCTATTTTTAAACATTT

TTAATCACAAGCTGTATTAGCTTTGCTGCTATATAGGTGTTATGTGTAAATGTCACCTATTAATACGGGATTGAAAACGTTAGAGACACACTGCATTGCG

GATGAAATGCAGGCAGCACAATATGGCCGGAACTGCCATAGTTTAGAATGTGAAACAATGCATGTTTACTTACCTGTGTCCACCATATGCATGCACTCGG

ACATTAACTAACGAGGTGAGGTATTGCAGATGTTCAAAAAGCTCTCTTGAATCTAGGTAGCATGAACAAATTAGAAAATTTGTTTCTTTACAAAAAAGCA

AACTTGCATGCATTATTGTGACTTCAAGTTAAAAATGTTGTCCTACATGTGTACAATATGCAAATTAGTTTTAGATTAGAGAGTGCAGCCATTTTGTGAT

CTGGTCAGTAGTGGAATTCGATTTTATGCAGACTGGATGTAATATTTGTAATCCCTGTGCAATTTTGTGATGTGCGGTTCTAATTCATGTGCAGTGATAT

AGTAT
Translation
 MNLPQQQPPAAAPQQPQSRRSPVSPQLQQQHQAAAAAFLQQRNSYNHHQ PLLKQSPWSNHQNSGWGTASMSWGAMHGRDHRRSGNMGIPGTMNQISPL

KKPFSGNVIAPPKFTRSTPSLTPKSWIEDNVFRTDNNSNTLLPLQ - UNI30279 - DRSRMYDSLNMHSLENSLIDIMRAEHDPLKG GRLSYPHPG

TDNLLMLNA AHIAFRVTDIWMCGLGFSSNILQFVLCLHAARSYGRRRG GRSSLFPIDDSLLDDGHSDQVGVLNSPTCYSAHQNGERIERFSRKVFVGG

LPPDIDED DEITASFRRFGPLVVDWPHKAESKSYFPPKG GYAFLLFQEESSVQALIDACIEEDGKLYLCVSSPTIKDKP VQIRPWNLSDSDFVMDGS

QPLDPRKTIFVGGVPRPLRAV VELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKR VEVKPYVLDDQMCDEC

QGARCGGKFAPFFCANVTCLQYYCEFCWANIHSRAGREFHKPLVKEGADRPRQIHFRWN
Transcript ENSMUST00000051378
Sequence
AGCAGCTGAGCAGCCAGAAGAGGAAAGAGTTGAGCCCGCCACACCGTCCCCACCCTCCGG CGGCGGCTTCGGCGGCCCGTTCTCTGCTCCCACGGTGCC

CGCGCCGCCCGCCATGAATTTACCTCAACAGCAGCCGCCGGCGGCGGCGCCGCAGCAGCCGCAGAGCCGGAGGTCACCCGTCAGCCCGCAGCTGCAGCAG

CAGCACCAGGCTGCCGCAGCCGCCTTCCTGCAGCAGAGGAACTCGTACAACCACCACCAG CCTCTTCTGAAACAGTCTCCTTGGAGCAACCATCAGAAC

AGCGGTTGGGGCACTGCGAGCATGTCCTGGGGAGCAATGCACGGCAGAGATCACCGCAGGAGCGGCAACATGGGGATCCCAGGGACTATGAATCAGATAT

CTCCGCTGAAGAAGCCGTTCTCGGGTAATGTTATAGCACCACCGAAATTCACTCGCTCTACTCCATCACTGACTCCAAAATCTTGGATTGAAGATAATGT

GTTCAGGACAGACAACAATAGTAACACACTCTTACCCTTACAG GTGAGATCTAGTTTGCAGTTGCCAGCTTGGGGCTCAGATTCACTCCAAGATAGTTG

GTGCACTGCAGCCGGAACATCCAGAATAGACCAG - UNI30279 - GATCGAAGTAGAATGTATGATAGCTTGAATATGCACTCTCTGGAAAATTCCC

TTATTGATATCATGAGAGCAGAGCACGATCCTCTCAAGG GTCGTCTGAGCTATCCACATCCAGGAACCGACAATCTGTTAATGTTAAATG GTCGCTCT

TCCCTATTTCCAATAGATGATAGCTTGTTGGATGATGGTCACAGTGATCAAGTTGGTGTTTTAAATTCACCAACATGTTATTCAGCTCATCAAAATGGAG

AACGAATTGAACGCTTCTCTCGAAAAGTTTTTGTTGGTGGGCTTCCTCCGGATATTGATGAAG ATGAGATCACTGCCAGCTTCCGAAGATTTGGACCTT

TGGTAGTAGATTGGCCCCACAAAGCAGAAAGTAAATCCTATTTTCCACCAAAAG GCTATGCATTCCTCCTCTTTCAAGAAGAGAGCTCAGTCCAGGCAC

TCATTGACGCTTGCATTGAAGAAGATGGAAAGCTCTACTTGTGTGTTTCCAGCCCTACTATCAAAGACAAACCT GTTCAAATCCGTCCTTGGAATTTAA

GTGATAGTGATTTCGTCATGGATGGTTCTCAGCCTTTGGATCCCCGAAAAACAATTTTTGTTGGAGGTGTTCCTAGGCCACTAAGGGCTG TGGAACTTG

CTATGATCATGGACCGGCTGTATGGTGGTGTGTGTTACGCAGGAATTGATACAGATCCAGAACTCAAATACCCAAAAGGTGCTGGGCGAGTCGCTTTCTC

CAATCAGCAGAGCTACATTGCTGCCATCAGTGCTCGATTTGTTCAGCTTCAGCACGGTGACATTGATAAACGT GTGGAGGTGAAGCCATATGTGCTAGA

TGACCAGATGTGTGACGAGTGCCAGGGTGCACGCTGTGGTGGGAAATTTGCCCCCTTTTTCTGTGCCAATGTCACCTGCCTGCAGTATTACTGTGAGTTT

TGTTGGGCAAATATCCACTCTCGTGCAGGACGCGAGTTCCATAAGCCATTGGTGAAGGAAGGTGCTGATCGCCCACGTCAGATCCACTTCCGCTGGAACT

AAGTATAGCCAACTGGCCTCGGTCTAGGAAGGAAGGAAAGGGTGCATGTGGCTTACTGTGCTGAAGACACTGACGTGCAGAAGAAATAAGTGCATTCTCC

TGCTGCTCACCCAGCTCTCGATACATGCATCGTTATCAGCAGCCAAAACACTACAAGCCTCTTGTTTTTCACCAAAACCCTACATCTCAGGCTTACTAAT

TTTTGTGATATTTTCATGTTAAAATAAAATGTTTTTTTGTATTTTC
Translation
 MNLPQQQPPAAAPQQPQSRRSPVSPQLQQQHQAAAAAFLQQRNSYNHHQ PLLKQSPWSNHQNSGWGTASMSWGAMHGRDHRRSGNMGIPGTMNQISPL

KKPFSGNVIAPPKFTRSTPSLTPKSWIEDNVFRTDNNSNTLLPLQ VRSSLQLPAWGSDSLQDSWCTAAGTSRIDQ - UNI30279 - DRSRMYDSLN

MHSLENSLIDIMRAEHDPLKG GRLSYPHPGTDNLLMLNG GRSSLFPIDDSLLDDGHSDQVGVLNSPTCYSAHQNGERIERFSRKVFVGGLPPDIDED 

DEITASFRRFGPLVVDWPHKAESKSYFPPKG GYAFLLFQEESSVQALIDACIEEDGKLYLCVSSPTIKDKP VQIRPWNLSDSDFVMDGSQPLDPRKTI

FVGGVPRPLRAV VELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKR VEVKPYVLDDQMCDECQGARCGGKF

APFFCANVTCLQYYCEFCWANIHSRAGREFHKPLVKEGADRPRQIHFRWN

For any suggestions or comments, please send an email to unitrap@crg.es