Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000039787 (Cercam)
Chromosomal location
Chr 2: 29725014 - 29738360 (+)
Description
cerebral endothelial cell adhesion molecule Gene [Source:MGI (curated);Acc:Cercam-001]
RefSeq_dna
NM_207298 
RefSeq_peptide
NP_997181.1 
UniGene
Mm.296336 Mm.413349 
MGI
MGI:2139134 
Uniprot/SWISSPROT
A3KGW5 
Uniprot/SPTREMBL
B2RSF7 
Human Ortholog
ENSG00000167123 (CERCAM)
Omim not available
UniTrap UNI32427
Vector Insertion
Chr 2: 29733657 - 29736132
Public Clones IST13938C2 (tigm) IST12641B6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 67% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28366
Vector Insertion
Chr 2: 29736639 - 29737215
Public Clones not available
Private Clones OST32701 (lexicon)
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000047521
Sequence
TGTGGTGGGAAACCCGGGGCCCTCCACAGCCACCGAGTCCCGCCATGCACGTTGCGCGGCTCCTACCTCTGCTGCTCCTGTTGGGGCAGCAGCTCCGGGC

TGCCAGTGTCACAGAGCCGACGCTACCCACCGTGGTCCTTGCCATCCTGGCCCGCAATGCTGAACACTCTCTGCCCCACTACCTGGGTGCGCTGGAGCGC

CTGGACTACCCCCGGGCCAGGCTGGCCCTCTG GTGTGCCACAGATCACAACATGGACAACACCACAGGGATGCTCCGGGAATGGCTGGCTGCTGTGGGT

CGGGACTATGCGACTGTCGTCTGGAAGCCTGAGGAGGAGGCCAG GTCCTACCCAGATGAACAGGGTCCCAAGCACTGGACCAAAGAACGGCATCAGTTT

TTGATGGAGCTGAGGCAGGAAGCACTGGCCTTTGCCAGGGACTGGGGAGCTGACTACATCCTG TTCGCAGATACAGACAACATTCTTACTAACAACCAG

ACACTGAAGCTTCTCATAGATCGGCAGCTGCCGGTGGTGGCCCCGATGCTGGACTCTCAGACCTATTATTCCAACTTTTGGTGTGGGATCACTCCACAG 

GGCTACTATCGCCGCACGGCTGAATACTTCCCTACTAAGAACCGCCAGCGCCAGGGCTGCTTCCGGGTCCCTATGGTCCACTCTACCTTCCTGCTGTCCT

TGCAGACTGAGGAAACAGCCCGGCTTGCCTTCTACCCTCCTCATCCCAACTACAGTTGGCCTTTTGATGACATCATTGTCTTTGCCTATGCCTGCCAGGC

TGCTG GGGTCTCGATGCATGTGTGCAATGACCATCGTTACGGGTACATGAATGTGGTAGTGAAGCCCCACCAGAGCCTGGAGGAAGAGAAGACGAACTT

TATCCACCTCATTTTGGAAGCACTAG TGGATGGGCCCCCCATGCTGGCCTCAGCTCATGTATCTCGGCCCCCAAAGAAGCTCAGCAAAATGGGGTTTGA

TGAA GTCTTTGTCATCAGCCTGGCCCGCAGACCCCAGCGCCGGGCTCGAATGCTGAGCTCTCTCTGGGAGATGGAGATATCTGCCCAGGTGGTAGATGC

TGTAGATGGCAG GACACTCAACAGCAGTATCCTCAAACATCTCGGTGTGGACCTGCTCCCTGGCTACCAAGACCCCTATTCAGGCCACACACTGACCAA

GGGTGAGGTGGGCTGCTTCCTCAGCCACTACTCCATCTGGGAAGAG - UNI32427 - GTGGTTGCCAGGGGCCTGGCCCGGGTCGTGGTGTTTGAGG

ATGACGTACGCTTCAAGGACAACTTCCGGAGGCGGCTAGAACGGCTGATGGAGGACGTGCTGATTCAGAAGCTGTCATGGGACTTGAT CTACCTTGGCC

GGAAGCAGGTGAACCCTGAGGAGGAAGTGGCTGTGGAGGGGCTGCCTGGTCTCGTGGTGGCCGGGTATTCCTACTGGACACTTGCGTACACCTTGAGCCT

GGCAGGCGCTCGCAAACTGTTAGCATCCCAGCCCCTGCATCGCATGCTACCTGTGGATGAATTCCTGCCTGTCATGTTTGATCGCCACCCAAA - UNI2

8366 - TGACCAGTACAAAGCATACTTCTGGCCTCGGGACCTCCAAGCCTTCTCAGCTAGGCCTCTGCTTGCCTCCCCCACCCACTATTCGGGAGACGC

CGAGTGGCTCAGTGACACAGAGACATCCTCCCCCTGGGACGATGACAGTGGTCGCCTCATTAGCCAGACTGGCTCTCAAAAGGCCCTTCGTGGCCCCCAC

CTGCACCTGACTGGCAGCAGTGGACACAGCCTCCATCCTCACCACAGGGATGAACTGTAGGTGAAGCTGGACCTAGAAGAGGACCAGTCCACGGCCCGGG

CTTCCCTTCTCAGCTCTCTCCTCCTCCCTCCTCCTGCTTCTCTCCCATCCCCAACCCACCTCTTGTCTACTTCTCTCTGATTTCTCTAGCTTTGTCTCTG

TCTTGTCTCTGTATCTGCCTCTCTACCTGTCTGTCTCTCTCCATAGCTGTTGACATCTCTACATCTGATTTTCCTTTTCTTTCTCTTGCCCCCTTGACCG

CTAGCCCATGAGGTCCAAGTGGGAATCCAAATGAGCGATGAGAGGGGAGAGGAAGAGGTGACAGCCAGCAGAAATCTGACTGTTATTTTGGGCTCAGCTA

GTTTTCTGTCCTCTGGACTCATTCCAAGGGAGGAGAAGCACTCAGAGACAGAGTCCACTCCTGAAGGTCTCAGAGTGAAGACACTAAGACCCCCAAGACT

TTTTTTTTTTTTTTTTTTTTGTGACAGGGTTTTTCTGTGTAGCCCTGGCTGTCCTGGAACTCACTTTGTACACCAGGCTGGACTTGAACTCAGAAATCCG

CCTGCCTCTGCCTCCCAAGTGCTGGGATTAAAGGCGTGCACCACCACTGCCTGGCTACCCCAAGACTCTTGACTCTGCTTGCAAATTTAGAGCCAGTGGG

CTCAGGGACAGGGAGGCCTCAGCCTTTGGGGTTTCAAGCTGGCTGGAGCCCAGAGTCCTGCCCTCTGAGGACCCAACTACTTTGCCTCCATCTACCTCCG

CCTTGGTGATTCCCTCCCTGCCTCACATCTGGGGCCCATTAGCACCCTCTTTCCTGGTTGGTGGAAAGTGCAAGAAGATGGGAGGCATACCTGGTGCTCA

ACACGCAGTAGGCCTTCAATAAAAGCCACTTGCATTAGCATTTTATACTTCA
Translation
MHVARLLPLLLLLGQQLRAASVTEPTLPTVVLAILARNAEHSLPHYLGALERLDYPRARLALW WCATDHNMDNTTGMLREWLAAVGRDYATVVWKPEEE

AR RSYPDEQGPKHWTKERHQFLMELRQEALAFARDWGADYIL FADTDNILTNNQTLKLLIDRQLPVVAPMLDSQTYYSNFWCGITPQ GYYRRTAEYF

PTKNRQRQGCFRVPMVHSTFLLSLQTEETARLAFYPPHPNYSWPFDDIIVFAYACQAAG GVSMHVCNDHRYGYMNVVVKPHQSLEEEKTNFIHLILEAL

V VDGPPMLASAHVSRPPKKLSKMGFDE VFVISLARRPQRRARMLSSLWEMEISAQVVDAVDGR RTLNSSILKHLGVDLLPGYQDPYSGHTLTKGEVG

CFLSHYSIWEE - UNI32427 - VVARGLARVVVFEDDVRFKDNFRRRLERLMEDVLIQKLSWDLI IYLGRKQVNPEEEVAVEGLPGLVVAGYSYWT

LAYTLSLAGARKLLASQPLHRMLPVDEFLPVMFDRHPN - UNI28366 - NDQYKAYFWPRDLQAFSARPLLASPTHYSGDAEWLSDTETSSPWDDDS

GRLISQTGSQKALRGPHLHLTGSSGHSLHPHHRDEL

For any suggestions or comments, please send an email to unitrap@crg.es