Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000039804 (Ncoa5)
Chromosomal location
Chr 2: 164825860 - 164860317 (-)
Description
nuclear receptor coactivator 5 Gene [Source:MGI (curated);Acc:Ncoa5-007]
RefSeq_dna
NM_144892 
RefSeq_peptide
NP_659141.1 
UniGene
Mm.233080 Mm.470785 
MGI
MGI:2385165 
Uniprot/SWISSPROT
Q91W39 
Uniprot/SPTREMBL
A2A5L2 A2A5L3 Q8BX12 
Human Ortholog
ENSG00000124160 (NCOA5)
Omim not available
UniTrap UNI19977
Vector Insertion
Chr 2: 164848713 - 164860182
Public Clones (sanger) IST14953A12 (tigm) IST14945D11 (tigm) IST14855A12 (tigm)
IST14832G11 (tigm) IST14928B3 (tigm) IST13606A5 (tigm) IST13063H3 (tigm)
IST14928E1 (tigm) IST14863A7 (tigm) IST14942D5 (tigm) IST14945D10 (tigm)
IST14892F7 (tigm) IST14599H1 (tigm) IST14951A10 (tigm) IST14802G12 (tigm)
IST11993H10 (tigm) IST14827A7 (tigm) IST14893A10 (tigm) IST14953H6 (tigm)
IST13633A3 (tigm)
Private Clones OST376092 (lexicon) OST184799 (lexicon) OST98051 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26133
Vector Insertion
Chr 2: 164838663 - 164848645
Public Clones (sanger)
Private Clones OST135409 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000040381
Sequence
GCGCCTTTGTCCTACGGCGGGCAGGTGGGCAGAGGCCGAGGCGGCAGCGGCGGGCCTGAGGCGGAGGAGCGGCGGGGAGGCGGCCACGCCGGTAGCG - 

UNI19977 - ATATTAATAAGGCAGCGGAAAGAAGAAATATGAATACGGCTCCATCAAGACCCAGCCCCACACGAAG - UNI26133 - GGATCCCT

ATAGCTTTGGAGATAGTCGCGATACAAGGCGTGATCGCTCTCCAATTCGAGGAAGTCCAAGGAGAGAACCCAGGGATGGCAGAAATGGCCGGGATGCCCG

TGATAGCAGAGACATTCGAGATCCTCGGGATTTGCGGGACCGCAGAGACAGCAGGGACATTCGGGATCACAGAGACAGCAGAAGTGTACGTGAAGCCCGG

GACCTGAGGGATTTTCGGGACTTTCGTGATCTAAGAGACTCTAGAGATTTTCGAGATCATCGAGACCCTGTGTATGACAGATACAGAGATATAAGAGATT

CCAGAGACCCTTTGTACAG GAGAGAAGGCTCATATGACCGTTATCTGAGGGTGGATGACTATTGCCGGAGGAAGGATGACTCGTACTTTGACCGGTACA

GAGATAGCTTTGATGGACGGGGCCCTCCTGGCCCAGAGAGTCAATCTCGAGCAAAAG AGCGTTTGAAACGTGAGGAACGACGTAGAGAGGAGCTTTATC

GTCGGTATTTTGAGGAGATCCAGCGACGCTTTGATGCTGAGAGGCCTGTGGATTGCTCAGTTATTGTGGTCAACAAACAGACTAA AGACTATGCTGAGT

CTGTGGGGAGGAAGGTGCGAGACCTGGGCATGGTCGTGGACCTGATCTTCCTCAACACAGAGGTGTCCCTCTCACAAGCGCTGGAGGATGTCAGCAGAGG

AGGCTCTCCCTTCGCCATTGTCATCACCCAGCAGCACCAGATTCACCGTTCCTGCACAGTCAACATCATGTTCGGAACACCACAAG AGCATCGCAACAT

GCCCCAGGCAGATGCCATGGTGCTGGTGGCCAGAAATTACGAGCGCTACAAGAATGACTGTCGAGAAAAGGAACGTGAGGAGATTGCCCGACAGGCAGCC

AAAATGGCTAATGACGCCATCCTCCAGGAAAGAGATCGTGGGGGCCCTGAAGAGGGAGGTCGTGGAGGGCACCCTCCAGCTATCCAGAGCCTCATCAACC

TCCTGGCAGATAACAGATACCTCACTGCCGAGGAGACGGACAAGATCATCAACTACCTGCGCGAGCGGAAGGAGCGGCTCCTGAGGAGCAGCGCCGACTC

TCTGCCTG GCCCGATTTCCCGCCAGCCACTCGGGGCGGCCTCGGGTTCCTCGCTGAAGTCACAACCAAGTTCACAACCGCTTCAGAGCGGCCAAGTGCT

CCCTTCTGCTACACCCACTCCAGCCGCACCCCCCACCTCCCAGCAAGAGCTTCAGGCCAAAATCCTCAGCCTCTTCAATAGTGGCGCGGTTGCGGCCAAC

AGCAGCTCTGCATCCCCCTCAGTGGCTACCGGAAGCTCCCAGAACCAGAATTTTTCCACAGCAGCAAACAGCCAGCCTCAGCAAAGACCGCAGGCCTCAG

GAAATCAGCCTCCAAACATTGTGGGACAGGCAGGGTCTGCTCGGAACATGGGCCCTAGGCCTGGGGCTCCTTCCCAAGGGCTCTTTGGTCAGCCTTCCAG

TCGCCTGGCACCCGCCAGCACCATGGCTAGCCAGAGGCCTGTATCTTCCACAGGTATTAACTTTGACAATCCAAGTGTACAAAAGGCTCTGGACACCCTG

ATTCAGAGTGGCCCTGCCCTTTCCCACCTGGTTAGCCAAACTGCAGCACAGGTGGGGCGGCCCCAGGCCCCCATGGGATCTTACCAGAGGCATTACTGAG

GCTCTACTGGTCTACTGTTCCTAGCCCCACCCTTCCCTGGCCCCTCCTACTTCATCCTAAGTAGAGTTGTTTGGAAGTGTTCGAAACACTTTCCAGGTCA

ACATCAAATATCCTAAGTTTCTCTCACCACTCCTTCCTGCGGCTGTTGCTTATCACTTATCAGAATCAGAACTTAGACTGCATTCGGGGCTGGATCTTTT

GTTTGGGTAGAAGATAAGTGTTCTGGGATCTGGGCTCAGCTTCTGTCTGGGATCGCTCTGGCACCTGCCTGGCAGATTTGGAGGAACAGGAAGAAGCCAA

GCGCAGCTGCCCTATGGGAACACCATTTCTGGAGGCAGTGGTCATAGCCTTAGTTTTCACCTCCACAGCAGCCAGAGCTGCGTCCTGCCTGGCTCCCAGT

GAAGCCAGGTGGTCTTGGCAGACAGTGTCATCATTGTTCCATCAGAGAATAGAACTCCAAGGACTCAAGAGTGATTTCTCTGGACTGTGAAGTGCCATGT

GGCAGCCAGAGAAGAGAGGACTCTTGTGACTGCATCAGAGTGGTCCCTTGAAGTTGGTTTGGTTTCGTATTTTTTATTTTCCTGGAGGGTCTGCAGACAA

GTGAGCAGCTCTCTTGGCACTTTGACATGAACTGTGACTCTGGGGCCCACTGCTCTCCACAGCGTTAGCTGCACCTTTCTCTCCGGCTGCACCTCATGCA

GTCAGCACTGGGGGCAGCTCCAGGCTCTGGAGCTGGACACCTTGGTGGTCCGTGATTTCTTTTGAGCCCCAGGCTTTTGTTTTCATTCAGACTCTTGTTC

TGTTTTCTGATGAGCAGGAGACGGGGACCACTTGATGGTAGACTGTGGTAGTTGGGTATGTTCTCATACAGAAGAGCATTCGTGTAACTTCTGAGACAGG

GTGATGTTTAGAGAAGGGCTCTGGCTGCTGCCCTGAATGGAGCCAGAGGAAGAAGCGCCTTTTCCTTTGGGAAAGGCTGCTCATTAAATGAAGTGAGGAT

CAGGTCAGGGGAGGGTCAGGCCTGGCTGGGCGGCAAGAGTGCTAACTCCAGTCCAGTCCCTGCCAGAGGCTGAGCAAACCAGTTTCAAAAGCTAAGTCCC

CAAATGGCAGCAGTTTATGTTCTGATCTGTTTGTGTTATACGGTGGGTCCCCCTCCCCCTTTGGAACTCTTGTGTTGTTGATAAAATGAAATAATTACTT

TTTAATTAAAATG
Translation
 - UNI19977 - MNTAPSRPSPTRR - UNI26133 - RDPYSFGDSRDTRRDRSPIRGSPRREPRDGRNGRDARDSRDIRDPRDLRDRRDSRDIRD

HRDSRSVREARDLRDFRDFRDLRDSRDFRDHRDPVYDRYRDIRDSRDPLYR RREGSYDRYLRVDDYCRRKDDSYFDRYRDSFDGRGPPGPESQSRAKE 

ERLKREERRREELYRRYFEEIQRRFDAERPVDCSVIVVNKQTK KDYAESVGRKVRDLGMVVDLIFLNTEVSLSQALEDVSRGGSPFAIVITQQHQIHRS

CTVNIMFGTPQE EHRNMPQADAMVLVARNYERYKNDCREKEREEIARQAAKMANDAILQERDRGGPEEGGRGGHPPAIQSLINLLADNRYLTAEETDKI

INYLRERKERLLRSSADSLPG GPISRQPLGAASGSSLKSQPSSQPLQSGQVLPSATPTPAAPPTSQQELQAKILSLFNSGAVAANSSSASPSVATGSSQ

NQNFSTAANSQPQQRPQASGNQPPNIVGQAGSARNMGPRPGAPSQGLFGQPSSRLAPASTMASQRPVSSTGINFDNPSVQKALDTLIQSGPALSHLVSQT

AAQVGRPQAPMGSYQRHY
Transcript ENSMUST00000121377
Sequence
GGCCGCCATTGCCTCGTGCCCGCGCTAGTCGGTTGGTGGCGCCTTTGTCCTACGGCGGGCAGGTGGGCAGAGGCCGAGGCGGCAGCGGCGGGCCTGAGGC

GGAGGAGCGGCGGGGAGGCGGCCACGCCGGTAGCG - UNI19977 - - UNI26133 - GGATCCCTATAGCTTTGGAGATAGTCGCGATACAAGGC

GTGATCGCTCTCCAATTCGAGGAAGTCCAAGGAGAGAACCCAGGGATGGCAGAAATGGCCGGGATGCCCGTGATAGCAGAGACATTCGAGATCCTCGGGA

TTTGCGGGACCGCAGAGACAGCAGGGACATTCGGGATCACAGAGACAGCAGAAGTGTACGTGAAGCCCGGGACCTGAGGGATTTTCGGGACTTTCGTGAT

CTAAGAGACTCTAGAGATTTTCGAGATCATCGAGACCCTGTGTATGACAGATACAGAGATATAAGAGATTCCAGAGACCCTTTGTACAG AGCGTTTGAA

ACGTGAGGAACGACGTAGAGAGGAGCTTTATCGTCGGTATTTTGAGGAGATCCAGCGACGCTTTGATGCTGAGAGGCCTGTGGATTGCTCAGTTATTGTG

GTCAACAAACAGACTAA AGACTATGCTGAGTCTGTGGGGAGGAAGGTGCGAGACCTGGGCATGGTCGTGGACCTGATCTTCCTCAACACAGAGGTGTCC

CTCTCACAAGCGCTGGAGGATGTCAGCAGAGGAGGCTCTCCCTTCGCCATTGTCATCACCCAGCAGCACCAGATTCACCGTTCCTGCACAGTCAACATCA

TGTTCGGAACACCACAAGGTACAGAG AGCATCGCAACATGCCCCAGGCAGATGCCATGGTGCTGGTGGCCAGAAATTACGAGCGCTACAAGAATGACTG

TCGAGAAAAGGAACGTGAGGAGATTGCCCGACAGGCAGCCAAAATGGCTAATGACGCCATCCTCCAGGAAAGAGATCGTGGGGGCCCTGAAGAGGGAGGT

CGTGGAGGGCACCCTCCAGCTATCCAGAGCCTCATCAACCTCCTGGCAGATAACAGATACCTCACTGCCGAGGAGACGGACAAGATCATCAACTACCTGC

GCGAGCGGAAGGAGCGGCTCCTGAGGAGCAGCGCCGACTCTCTGCCTG GCCCGATTTCCCGCCAGCCACTCGGGGCGGCCTCGGGTTCCTCGCTGAAGT

CACAACCAAGTTCACAACCGCTTCAGAGCGGCCAAGTGCTCCCTTCTGCTACACCCACTCCAGCCGCACCCCCCACCTCCCAGCAAGAGCTTCAGGCCAA

AATCCTCAGCCTCTTCAATAGTGGCGCGGTTGCGGCCAACAGCAGCTCTGCATCCCCCTCAGTGGCTACCGGAAGCTCCCAGAACCAGAATTTTTCCACA

GCAGCAAACAGCCAGCCTCAGCAAAGACCGCAGGCCTCAGGAAATCAGCCTCCAAACATTGTGGGACAGGCAGGGTCTGCTCGGAACATGGGCCCTAGGC

CTGGGGCTCCTTCCCAAGGGCTCTTTGGTCAGCCTTCCAGTCGCCTGGCACCCGCCAGCACCATGGCTAGCCAGAGGCCTGTATCTTCCACAGGTATTAA

CTTTGACAATCCAAGTGTACAAAAGGCTCTGGACACCCTGATTCAGAGTGGCCCTGCCCTTTCCCACCTGGTTAGCCAAACTGCAGCACAGGTGGGGCGG

CCCCAGGCCCCCATGGGATCTTACCAGAGGCATTACTGAGGCTCTACTGGTCTACTGTTCCTAGCCCCACCCTTCCCTGGCCCCTCCTACTTCATCCTAA

GTAGAGTTGTTTGGAAGTGTTCGAAACACTTTCCAGGTCAACATCAAATATCCTAAGTTTCTCTCACCACTCCTTCCTGCGGCTGTTGCTTATCACTTAT

CAGAATCAGAACTTAGACTGCATTCGGGGCTGGATCTTTTGTTTGGGTAGAAGATAAGTGTTCTGGGATCTGGGCTCAGCTTCTGTCTGGGATCGCTCTG

GCACCTGCCTGGCAGATTTGGAGGAACAGGAAGAAGCCAAGCGCAGCTGCCCTATGGGAACACCATTTCTGGAGGCAGTGGTCATAGCCTTAGTTTTCAC

CTCCACAGCAGCCAGAGCTGCGTCCTGCCTGGCTCCCAGTGAAGCCAGGTGGTCTTGGCAGACAGTGTCATCATTGTTCCATCAGAGAATAGAACTCCAA

GGACTCAAGAGTGATTTCTCTGGACTGTGAAGTGCCATGTGGCAGCCAGAGAAGAGAGGACTCTTGTGACTGCATCAGAGTGGTCCCTTGAAGTTGGTTT

GGTTTCGTATTTTTTATTTTCCTGGAGGGTCTGCAGACAAGTGAGCAGCTCTCTTGGCACTTTGACATGAACTGTGACTCTGGGGCCCACTGCTCTCCAC

AGCGTTAGCTGCACCTTTCTCTCCGGCTGCACCTCATGCAGTCAGCACTGGGGGCAGCTCCAGGCTCTGGAGCTGGACACCTTGGTGGTCCGTGATTTCT

TTTGAGCCCCAGGCTTTTGTTTTCATTCAGACTCTTGTTCTGTTTTCTGATGAGCAGGAGACGGGGACCACTTGATGGTAGACTGTGGTAGTTGGGTATG

TTCTCATACAGAAGAGCATTCGTGTAACTTCTGAGACAGGGTGATGTTTAGAGAAGGGCTCTGGCTGCTGCCCTGAATGGAGCCAGAGGAAGAAGCGCCT

TTTCCTTTGGGAAAGGCTGCTCATTAAATGAAGTGAGGATCAGGTCAGGGGAGGGTCAGGCCTGGCTGGGCGGCAAGAGTGCTAACTCCAGTCCAGTCCC

TGCCAGAGGCTGAGCAAACCAGTTTCAAAAGCTAAGTCCCCAAATGGCAGCAGTTTATGTTCTGATCTGTTTGTGTTATACGGTGGGTCCCCCTCCCCCT

TTGGAACTCTTGTGTTGTTGATAAAATGAAATAATTACTTTTTAATTAAAATGAAAAAGTC
Translation
 - UNI19977 - - UNI26133 -    MPQADAMVLVARNYERYKNDCREKEREEIARQAAKMANDAILQERDRGGPEEGGRGGHPPAIQSLINLLA

DNRYLTAEETDKIINYLRERKERLLRSSADSLPG GPISRQPLGAASGSSLKSQPSSQPLQSGQVLPSATPTPAAPPTSQQELQAKILSLFNSGAVAANS

SSASPSVATGSSQNQNFSTAANSQPQQRPQASGNQPPNIVGQAGSARNMGPRPGAPSQGLFGQPSSRLAPASTMASQRPVSSTGINFDNPSVQKALDTLI

QSGPALSHLVSQTAAQVGRPQAPMGSYQRHY
Transcript ENSMUST00000122070
Sequence
CGGTTGGTGGCGCCTTTGTCCTACGGCGGGCAGGTGGGCAGAGGCCGAGGCGGCAGCGGCGGGCCTGAGGCGGAGGAGCGGCGGGGAGGCGGCCACGCCG

GTAGCG - UNI19977 - ATATTAATAAGGCAGCGGAAAGAAGAAATATGAATACGGCTCCATCAAGACCCAGCCCCACACGAAG - UNI26133 -

 GGATCCCTATAGCTTTGGAGATAGTCGCGATACAAGGCGTGATCGCTCTCCAATTCGAGGAAGTCCAAGGAGAGAACCCAGGGATGGCAGAAATGGCCG

GGATGCCCGTGATAGCAGAGACATTCGAGATCCTCGGGATTTGCGGGACCGCAGAGACAGCAGGGACATTCGGGATCACAGAGACAGCAGAAGTGTACGT

GAAGCCCGGGACCTGAGGGATTTTCGGGACTTTCGTGATCTAAGAGACTCTAGAGATTTTCGAGATCATCGAGACCCTGTGTATGACAGATACAGAGATA

TAAGAGATTCCAGAGACCCTTTGTACAG GAGAGAAGGCTCATATGACCGTTATCTGAGGGTGGATGACTATTGCCGGAGGAAGGATGACTCGTACTTTG

ACCGGTACAGAGATAGCTTTGATGGACGGGGCCCTCCTGGCCCAGAGAGTCAATCTCGAGCAAAAG AGCGTTTGAAACGTGAGGAACGACGTAGAGAGG

AGCTTTATCGTCGGTATTTTGAGGAGATCCAGCGACGCTTTGATGCTGAGAGGCCTGTGGATTGCTCAGTTATTGTGGTCAACAAACAGACTAA AGACT

ATGCTGAGTCTGTGGGGAGGAAGGTGCGAGACCTGGGCATGGTCGTGGACCTGATCTTCCTCAACACAGAGGTGTCCCTCTCACAAGCGCTGGAGGATGT

CAGCAGAGGAGGCTCTCCCTTCGCCATTGTCATCACCCAGCAGCACCAGATTCACCGTTCCTGCACAGTCAACATCATGTTCGGAACACCACAAG AGCA

TCGCAACATGCCCCAGGCAGATGCCATGGTGCTGGTGGCCAGAAATTACGAGCGCTACAAGAATGACTGTCGAGAAAAGGAACGTGAGGAGATTGCCCGA

CAGGCAGCCAAAATGGCTAATGACGCCATCCTCCAGGAAAGAGATCGTGGGGGCCCTGAAGAGGGAGGTCGTGGAGGGCACCCTCCAGCTATCCAGAGCC

TCATCAACCTCCTGGCAGATAACAGATACCTCACTGCCGAGGAGACGGACAAGATCATCAACTACCTGCGCGAGCGGAAGGAGCGGCTCCTGAGGAGCAG

CGCCGACTCTCTGCCTGGTGAGCTACGTGGCAGGGCCGAG GCCCGATTTCCCGCCAGCCACTCGGGGCGGCCTCGGGTTCCTCGCTGAAGTCACAACCA

AGTTCACAACCGCTTCAGAGCGGCCAAGTGCTCCCTTCTGCTACACCCACTCCAGCCGCACCCCCCACCTCCCAGCAAGAGCTTCAGGCCAAAATCCTCA

GCCTCTTCAATAGTGGCGCGGTTGCGGCCAACAGCAGCTCTGCATCCCCCTCAGTGGCTACCGGAAGCTCCCAGAACCAGAATTTTTCCACAGCAGCAAA

CAGCCAGCCTCAGCAAAGACCGCAGGCCTCAGGAAATCAGCCTCCAAACATTGTGGGACAGGCAGGGTCTGCTCGGAACATGGGCCCTAGGCCTGGGGCT

CCTTCCCAAGGGCTCTTTGGTCAGCCTTCCAGTCGCCTGGCACCCGCCAGCACCATGGCTAGCCAGAGGCCTGTATCTTCCACAGGTATTAACTTTGACA

ATCCAAGTGTACAAAAGGCTCTGGACACCCTGATTCAGAGTGGCCCTGCCCTTTCCCACCTGGTTAGCCAAACTGCAGCACAGGTGGGGCGGCCCCAGGC

CCCCATGGGATCTTACCAGAGGCATTACTGAGGCTCTACTGGTCTACTGTTCCTAGCCCCACCCTTCCCTGGCCCCTCCTACTTCATCCTAAGTAGAGTT

GTTTGGAAGTGTTCGAAACACTTTCCAGGTCAACATCAAATATCCTAAGTTTCTCTCACCACTCCTTCCTGCGGCTGTTGCTTATCACTTATCAGAATCA

GAACTTAGACTGCATTCGGGGCTGGATCTTTTGTTTGGGTAGAAGATAAGTGTTCTGGGATCTGGGCTCAGCTTCTGTCTGGGATCGCTCTGGCACCTGC

CTGGCAGATTTGGAGGAACAGGAAGAAGCCAAGCGCAGCTGCCCTATGGGAACACCATTTCTGGAGGCAGTGGTCATAGCCTTAGTTTTCACCTCCACAG

CAGCCAGAGCTGCGTCCTGCCTGGCTCCCAGTGAAGCCAGGTGGTCTTGGCAGACAGTGTCATCATTGTTCCATCAGAGAATAGAACTCCAAGGACTCAA

GAGTGATTTCTCTGGACTGTGAAGTGCCATGTGGCAGCCAGAGAAGAGAGGACTCTTGTGACTGCATCAGAGTGGTCCCTTGAAGTTGGTTTGGTTTCGT

ATTTTTTATTTTCCTGGAGGGTCTGCAGACAAGTGAGCAGCTCTCTTGGCACTTTGACATGAACTGTGACTCTGGGGCCCACTGCTCTCCACAGCGTTAG

CTGCACCTTTCTCTCCGGCTGCACCTCATGCAGTCAGCACTGGGGGCAGCTCCAGGCTCTGGAGCTGGACACCTTGGTGGTCCGTGATTTCTTTTGAGCC

CCAGGCTTTTGTTTTCATTCAGACTCTTGTTCTGTTTTCTGATGAGCAGGAGACGGGGACCACTTGATGGTAGACTGTGGTAGTTGGGTATGTTCTCATA

CAGAAGAGCATTCGTGTAACTTCTGAGACAGGGTGATGTTTAGAGAAGGGCTCTGGCTGCTGCCCTGAATGGAGCCAGAGGAAGAAGCGCCTTTTCCTTT

GGGAAAGGCTGCTCATTAAATGAAGTGAGGATCAGGTCAGGGGAGGGTCAGGCCTGGCTGGGCGGCAAGAGTGCTAACTCCAGTCCAGTCCCTGCCAGAG

GCTGAGCAAACCAGTTTCAAAAGCTAAGTCCCCAAATGGCAGCAGTTTATGTTCTGATCTGTTTGTGTTATACGGTGGGTCCCCCTCCCCCTTTGGAACT

CTTGTGTTGTTGATAAAATGAAATAATTACTTTTTAATTAAAATGAAAAA
Translation
 - UNI19977 - MNTAPSRPSPTRR - UNI26133 - RDPYSFGDSRDTRRDRSPIRGSPRREPRDGRNGRDARDSRDIRDPRDLRDRRDSRDIRD

HRDSRSVREARDLRDFRDFRDLRDSRDFRDHRDPVYDRYRDIRDSRDPLYR RREGSYDRYLRVDDYCRRKDDSYFDRYRDSFDGRGPPGPESQSRAKE 

ERLKREERRREELYRRYFEEIQRRFDAERPVDCSVIVVNKQTK KDYAESVGRKVRDLGMVVDLIFLNTEVSLSQALEDVSRGGSPFAIVITQQHQIHRS

CTVNIMFGTPQE EHRNMPQADAMVLVARNYERYKNDCREKEREEIARQAAKMANDAILQERDRGGPEEGGRGGHPPAIQSLINLLADNRYLTAEETDKI

INYLRERKERLLRSSADSLPGELRGRAE ARFPASHSGRPRVPR

For any suggestions or comments, please send an email to unitrap@crg.es