Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000039814 (Xkr5)
Chromosomal location
Chr 8: 18932729 - 18950975 (-)
Description
X Kell blood group precursor-related family, member 5 Gene [Source:MGI (curated);Acc:Xkr5-001]
RefSeq_dna
NM_176951 
RefSeq_peptide
NP_795925.1 NP_001106821.1 
MGI
MGI:2442327 
Uniprot/SWISSPROT
Q5GH66 
Uniprot/SPTREMBL
Q0VFY4 Q8BG78 
Human Ortholog
ENSG00000186530 (XKR5)
Omim not available
UniTrap UNI33247
Vector Insertion
Chr 8: 18950535 - 18950976
Public Clones IST14193B9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000055503
Sequence
GGGCACAGGCAGCAGCAGCTCAGAAGATGCACGCGGGGCTCCTGGGGCTCTCTGCCCTGCTGCAGGCGGCCGAGCAAAGCGCGCGTGAGTGAGGCGCAGC

CCGCGAGTGCTCACCCCTCCAATACCCTACTCCAACCCAGTGTGCGGGGCACATCTACCACCGCTGTGCCTCCTCCTCCTCCGGCAGGCAGGCAAGCGGC

GAACACTGCGCCGGTGCACGCACGATGATCTCCCGTCCTAGCCTGCAGAGCACTCCCTGTGTGATCCCCTCACCATGCATGATTTCCTCCATCCAGTTAG

ACATCCCTCCATGCATGGATCCTCCCCATACTCCAAACCCGGAGCCCTGAGTCCCTTCTCTCTCCTCTCGCTGGTGCTCTGCAAAGAGCTGCGTGAGGAG

GCTACTTTGGAGCGCCAGCACTTG - UNI33247 - GCCTCTGCTCCATAGTTTTCTACTTTGCCACGGGTCGTCTCCTCTGGGGGTGGCTGGCCCTT

TCTGTCCTCCTGCCCGGCTTCTTGGTCCAGGCCCTGAGCTTTCTGTGGTTCCGAGCAGATGGGCATCAGGGTCAGTGGTGGCTGGCGGTACTGCATCTTC

TGCAACTTGGCGTCTGGAAGCG GCACTGGGACTCTGTGGCAACGGCTCTGTGGAAGGGAAAGGAGGCTCCCAGCTGGGGACAGCTGCACCTGCAGGAGG

CTGACCTGTCAGCCCTACGGCTCCTGGAGGCTCTGCTGCAGACAGGGCCCCACCTGCTGCTTCAGGCTTACGTGTTCCTAGCCTCTGACTTCACAGACAT

TGTGCCAG GAATCAGTGCCCTACTCTCCTGGTCTTCACTGTCCTGGGCTCTAGTGTCATACAACCGTTTCCTGGGCATCATGAAGCCAGGCCACCATAC

CATGCTATGGGCTGCTCTCTTGTGCCAGCAGCTCTGGAGGATGGGCATGCTGGGTGCTCGTGTGCTAAGCCTGGTTCTGTTCTGCCGAGTTTACCGTGTG

TGGGTTTTGGTGGTTGGAG GTGCTCACTGGCTAGTGATGACCTTCTGGCTCGTGGCCCAGCAGAGCGACATTGTAGAGAGCACCTGCCACTGGAGGCTG

TTCAATCTGCTGGTGGGGGCCGTGTTCATCCTCTGCTACATCAATTTCTGGGACAGCCCTTCCAGAAGCAGGGTGGCCAGCTTCTACTTG GTTATGCTG

CTGGAGAACTCCATACTCTTACTACTGGCCACTGACTTTCTGCAGGGAGTACCAGGGACCAGCCTGTGGACTGTGGTGGGAGTCTTGTCTGGATTTCTGA

TTG GGTGTGCATCGCTGGTTATTTATTACAGCTTACTACACCCTAAGTCCTCAGACATCCAGCAGAGCTTCATGAGGAAATGCTGTGGCCCCATCGAGG

ATAACAAACCTGAATCAGAACCTCCTCCCAGGGCCGTGGATCCCACAGGGGAGATGCCAGACAGCTCAAGCTGGTGCCAAGAGGAAAGCTATGAGCTAAC

AAGTCTAGATAAGGCCCCCAGCCCAGAGCAGAACACTGCAGAGGTGGGGCTCGGGGAGCAGAGATCTGGGGAGTCCTCTTTCTTCAGCCACCACCACTGG

CTGTTGCTGAAACTCGCTCTCAAGACAGGAAGTGTATCTAGGATCAACGCAGCCCTCGGAGGTGACAGCCCTGGCTGCTCCTGTCCCCCTCTGCTGGGGT

CGAGTCAACACTGTGATCTGCAGAGGAAACCCCTGTTTTCCCATCAAGACCTCCCATCCTCTCCCTGTGACCCTTTGACCTTGGAGAAAGGGTCTGAGTA

CGTAGGGGCTCCGAAAGCAGAGATGGAGTCATTGGAAACTTCAAGCTATCTCTCCTTTGCCAGCGAGCTTGAGGACAATGCAACAACCCAGAAGCCACCA

GCTACCCAGGAGGACAGTCCAAAGCTGGCTGGGTCCAAGGCTGACCTTGCAGCTCAGGGGAAGGAGACAGAAGGTCCCCTGCAGGGGAAGGAAGGACAGG

AGAGCACAACACTGTATTTCAGTGCCGCCATGGACAGAACCACATCCCACCAAAGAGGCAGCCCAGTAGTTCTGCGGATATCCCACTCGGAGACTCTGGT

AGAGAGCAGACCTGGGCAGCCTGCGCTGCCTCAGGCAGTCACTAAGCCCTTTCCTGTTACCGTGGCCAATATTAGTCCCATTCCAGGTAGAAACTTCCGC

CCCAGTGCAGAGCTTCCTGGAAGAGCCCCAGATAGTTCAGAGTGTGAGGAGTGGAAGGACGCGGCAAGGGACCCGAGTATGCAGAGCTCATTGCCGAAGA

TGAGGCTGAAGGCAGCTGAAGAGCCCTGCTTCACATCTACCCCTAAGTCGGAGTCCATCCAAAGGGACTACAGCTGCAGGGACAGGGTGAGACAGGAGAT

GAGCTTTTTCATCTGACCCTAGCCGTGGTGGGATAAGACAACAGGTCAATACATCAGACTGGCCGCTCAGCATCATGGGAAGAGAAATCCCACACGCAAC

GCCTGAGTTCTTCTAATTCTGGCCTCCATCTGCATACCTGAAAAGACGAAGGGACGGGATTGGATGATGTCTAACCCCACACCCCACCCCACCCCCACCC

CCGTACGCATCAGACTTGGCACTGACGCACAGCAAAACTCACGGACAGTGGGAAGAAGCGAAGGGGCCTCCAGGTCCCTTTTCGAGCTGCTTGAACCCTA

CCTAGTATGTCTCTTCTCGGCTTCCAAAAAATGCAAAGGAAAGAATCCACTTGCATCCTGGGTCCTTTAACCTTTTAACCGATCCTCACATTGGATGGCT

ATTAATCACTTTTTAAAAAATTGTCTCCAAGGTCCCTTGAGGCAACGTATATAGCTGTTTGCAACCATTGCACACCAAAGCCCCACGGGGAAAGGAACTT

GGCCAGCTTAATCAGCTGCACTATTAATCACCTTTTTAAAAAATACTTTTGGGACTGAAGAGATGGCCCAGCAGTTAAGATCCTGCTCCTCCGGAGGACC

CAGGTTCAATTAATTCCCAGTATTTATTTGGTAACTCATGACCACCTGTAACTTCAGTGCCCGGGAGACAACAGTCATCTTCTGGCCTCTGTGCACACGG

CACACCCATGATTCATGTCATCTAGGCAGGCAAAATACCCCTACACCTAATAATTTTAAAAATAAAACCGTGTTTCCCAG
Translation
 - UNI33247 -   MKPGHHTMLWAALLCQQLWRMGMLGARVLSLVLFCRVYRVWVLVVGG GAHWLVMTFWLVAQQSDIVESTCHWRLFNLLVGAVF

ILCYINFWDSPSRSRVASFYL VMLLENSILLLLATDFLQGVPGTSLWTVVGVLSGFLIG GCASLVIYYSLLHPKSSDIQQSFMRKCCGPIEDNKPESE

PPPRAVDPTGEMPDSSSWCQEESYELTSLDKAPSPEQNTAEVGLGEQRSGESSFFSHHHWLLLKLALKTGSVSRINAALGGDSPGCSCPPLLGSSQHCDL

QRKPLFSHQDLPSSPCDPLTLEKGSEYVGAPKAEMESLETSSYLSFASELEDNATTQKPPATQEDSPKLAGSKADLAAQGKETEGPLQGKEGQESTTLYF

SAAMDRTTSHQRGSPVVLRISHSETLVESRPGQPALPQAVTKPFPVTVANISPIPGRNFRPSAELPGRAPDSSECEEWKDAARDPSMQSSLPKMRLKAAE

EPCFTSTPKSESIQRDYSCRDRVRQEMSFFI
Transcript ENSMUST00000095438
Sequence
GGGCAGGGGAAGGGGCGGGCACAGGCAGCAGCAGCTCAGAAGATGCACGCGGGGCTCCTGGGGCTCTCTGCCCTGCTGCAGGCGGCCGAGCAAAGCGCGC

 - UNI33247 - GCCTCTGCTCCATAGTTTTCTACTTTGCCACGGGTCGTCTCCTCTGGGGGTGGCTGGCCCTTTCTGTCCTCCTGCCCGGCTTCTTG

GTCCAGGCCCTGAGCTTTCTGTGGTTCCGAGCAGATGGGCATCAGGGTCAGTGGTGGCTGGCGGTACTGCATCTTCTGCAACTTGGCGTCTGGAAGCG G

CACTGGGACTCTGTGGCAACGGCTCTGTGGAAGGGAAAGGAGGCTCCCAGCTGGGGACAGCTGCACCTGCAGGAGGCTGACCTGTCAGCCCTACGGCTCC

TGGAGGCTCTGCTGCAGACAGGGCCCCACCTGCTGCTTCAGGCTTACGTGTTCCTAGCCTCTGACTTCACAGACATTGTGCCAG GAATCAGTGCCCTAC

TCTCCTGGTCTTCACTGTCCTGGGCTCTAGTGTCATACAACCGTTTCCTGGGCATCATGAAGCCAGGCCACCATACCATGCTATGGGCTGCTCTCTTGTG

CCAGCAGCTCTGGAGGATGGGCATGCTGGGTGCTCGTGTGCTAAGCCTGGTTCTGTTCTGCCGAGTTTACCGTGTGTGGGTTTTGGTGGTTGGAG GTGC

TCACTGGCTAGTGATGACCTTCTGGCTCGTGGCCCAGCAGAGCGACATTGTAGAGAGCACCTGCCACTGGAGGCTGTTCAATCTGCTGGTGGGGGCCGTG

TTCATCCTCTGCTACATCAATTTCTGGGACAGCCCTTCCAGAAGCAGGGTGGCCAGCTTCTACTTG GTTATGCTGCTGGAGAACTCCATACTCTTACTA

CTGGCCACTGACTTTCTGCAGGGAGTACCAGGGACCAGCCTGTGGACTGTGGTGGGAGTCTTGTCTGGATTTCTGATTG GGTGTGCATCGCTGGTTATT

TATTACAGCTTACTACACCCTAAGTCCTCAGACATCCAGCAGAGCTTCATGAGGAAATGCTGTGGCCCCATCGAGGATAACAAACCTGAATCAGAACCTC

CTCCCAGGGCCGTGGATCCCACAGGGGAGATGCCAGACAGCTCAAGCTGGTGCCAAGAGGAAAGCTATGAGCTAACAAGTCTAGATAAGGCCCCCAGCCC

AGAGCAGAACACTGCAGAGGTGGGGCTCGGGGAGCAGAGATCTGGGGAGTCCTCTTTCTTCAGCCACCACCACTGGCTGTTGCTGAAACTCGCTCTCAAG

ACAGGAAGTGTATCTAGGATCAACGCAGCCCTCGGAGGTGACAGCCCTGGCTGCTCCTGTCCCCCTCTGCTGGGGTCGAGTCAACACTGTGATCTGCAGA

GGAAACCCCTGTTTTCCCATCAAGACCTCCCATCCTCTCCCTGTGACCCTTTGACCTTGGAGAAAGGGTCTGAGTACGTAGGGGCTCCGAAAGCAGAGAT

GGAGTCATTGGAAACTTCAAGCTATCTCTCCTTTGCCAGCGAGCTTGAGGACAATGCAACAACCCAGAAGCCACCAGCTACCCAGGAGGACAGTCCAAAG

CTGGCTGGGTCCAAGGCTGACCTTGCAGCTCAGGGGAAGGAGACAGAAGGTCCCCTGCAGGGGAAGGAAGGACAGGAGAGCACAACACTGTATTTCAGTG

CCGCCATGGACAGAACCACATCCCACCAAAGAGGCAGCCCAGTAGTTCTGCGGATATCCCACTCGGAGACTCTGGTAGAGAGCAGACCTGGGCAGCCTGC

GCTGCCTCAGGCAGTCACTAAGCCCTTTCCTGTTACCGTGGCCAATATTAGTCCCATTCCAGGTAGAAACTTCCGCCCCAGTGCAGAGCTTCCTGGAAGA

GCCCCAGATAGTTCAGAGTGTGAGGAGTGGAAGGACGCGGCAAGGGACCCGAGTATGCAGAGCTCATTGCCGAAGATGAGGCTGAAGGCAGCTGAAGAGC

CCTGCTTCACATCTACCCCTAAGTCGGAGTCCATCCAAAGGGACTACAGCTGCAGGGACAGGGTGAGACAGGAGATGAGCTTTTTCATCTGACCCTAGCC

GTGGTGGGATAAGACAACAGGTCAATACATCAGACTGGCCGCTCAGCATCATGGGAAGAGAAATCCCACACGCAACGCCTGAGTTCTTCTAATTCTGGCC

TCCATCTGCATACCTGAAAAGACGAAGGGACGGGATTGGATGATGTCTAACCCCACACCCCACCCCACCCCCACCCCCGTACGCATCAGACTTGGCACTG

ACGCACAGCAAAACTCACGGACAGTGGGAAGAAGCGAAGGGGCCTCCAGGTCCCTTTTCGAGCTGCTTGAACCCTACCTAGTATGTCTCTTCTCGGCTTC

CAAAAAATGCAAAGGAAAGAATCCACTTGCATCCTGGGTCCTTTAACCTTTTAACCGATCCTCACATTGGATGGCTATTAATCACTTTTTAAAAAATTGT

CTCCAAGGTCCCTTGAGGCAACGTATATAGCTGTTTGCAACCATTGCACACCAAAGCCCCACGGGGAAAGGAACTTGGCCAGCTTAATCAGCTGCACTAT

TAATCACCTTTTTAAAAAATACTTTTGGGACTGAAGAGATGGCCCAGCAGTTAAGATCCTGCTCCTCCGGAGGACCCAGGTTCAATTAATTCCCAGTATT

TATTTGGTAACTCATGACCACCTGTAACTTCAGTGCCCGGGAGACAACAGTCATCTTCTGGCCTCTGTGCACACGGCACACCCATGATTCATGTCATCTA

GGCAGGCAAAATACCCCTACACCTAATAATTTTAAAAATAAAACCGTGTTTCCCAGA
Translation
MHAGLLGLSALLQAAEQSAR - UNI33247 - RLCSIVFYFATGRLLWGWLALSVLLPGFLVQALSFLWFRADGHQGQWWLAVLHLLQLGVWKR RHW

DSVATALWKGKEAPSWGQLHLQEADLSALRLLEALLQTGPHLLLQAYVFLASDFTDIVPG GISALLSWSSLSWALVSYNRFLGIMKPGHHTMLWAALLC

QQLWRMGMLGARVLSLVLFCRVYRVWVLVVGG GAHWLVMTFWLVAQQSDIVESTCHWRLFNLLVGAVFILCYINFWDSPSRSRVASFYL VMLLENSIL

LLLATDFLQGVPGTSLWTVVGVLSGFLIG GCASLVIYYSLLHPKSSDIQQSFMRKCCGPIEDNKPESEPPPRAVDPTGEMPDSSSWCQEESYELTSLDK

APSPEQNTAEVGLGEQRSGESSFFSHHHWLLLKLALKTGSVSRINAALGGDSPGCSCPPLLGSSQHCDLQRKPLFSHQDLPSSPCDPLTLEKGSEYVGAP

KAEMESLETSSYLSFASELEDNATTQKPPATQEDSPKLAGSKADLAAQGKETEGPLQGKEGQESTTLYFSAAMDRTTSHQRGSPVVLRISHSETLVESRP

GQPALPQAVTKPFPVTVANISPIPGRNFRPSAELPGRAPDSSECEEWKDAARDPSMQSSLPKMRLKAAEEPCFTSTPKSESIQRDYSCRDRVRQEMSFFI


For any suggestions or comments, please send an email to unitrap@crg.es