Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000039834 (Zfp335)
Chromosomal location
Chr 2: 164717393 - 164737250 (-)
Description
zinc finger protein 335 Gene [Source:MGI (curated);Acc:Zfp335-001]
RefSeq_dna
NM_199027 
RefSeq_peptide
NP_950192.2 
UniGene
Mm.330776 
MGI
MGI:2682313 
Uniprot/SPTREMBL
A2A5K6 B2RXR9 Q3TZT1 Q8C1Q2 Q6P5F4 
Human Ortholog
ENSG00000198026 (ZNF335)
Omim not available
UniTrap UNI1917
Vector Insertion
Chr 2: 164734944 - 164736121
Public Clones AY0030 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9742
Vector Insertion
Chr 2: 164730488 - 164732927
Public Clones XG241 (baygenomics) PST821-2 (escells)
Private Clones not available
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9989
Vector Insertion
Chr 2: 164728237 - 164730340
Public Clones XD120 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000041361
Sequence
CTCAGCCCTAACACCGGGCAGCATGTGACTTCTAGAGTCCTCCTGGACCCGACGACGGCTCTGAGTCCTCCGAGAGGCCTTCTGAAACCCCGCAGATCTC

TCTCTCCCGGGGGGACGGCGGCGGAAGTAGTTCCGGTTCGAGGGCGGCCGATGGGTTCCTCCGCGACGGGGGTGAGAGGATGGCGACCTCGTCGATGCCG

GAGTCGGAGAGCGACACAGCAGCCAGAGGCTCAG AGTGAAAGCCTCAAACCCCGCGCTTCGCTGTCAGTCGGTCCCCAGAACCAATGGAGGAGAACGAG

GTGGAGAGCAGTAGCGACGCGGCCCCTCGGCCCGGCCAGCCTGAGGAGCCTTCTGAGAGCGGCCTGGGTGTGTGCACCTCGGAAGCTGTGTCCGCGGACA

GCAGCGACGCTGCGACCGTCCCAGGATTAACGGAGGCTGACGACTCTGGCGTCGGGCAGAGCTCGGACGGTGGCAACCACTCTGTG - UNI1917 - G

AGGAGGTATCTGAGAGCATCTCAACAGACCCTTTGCCTCATGGCTGCCTCCCTGATTCATCTTCTGTGTCCCGGGGACCAGTAGCAGAGATGCCTGGTGG

CCCCCCAGCTCTGGTGCATTCCAGTGTTCTCCCAGACCCCAGCATGCTGGTGTCTGACTGCACAGCCTCCTCTTCAGACCTAGGCTCTGCCATTGACAAG

ATCATCGAATCTACCATTGGTCCAGACCTCATCCAGA GCTGCATCACTGTGACCAGTGGTGAAGAGGGAGGAGCTGAGACCACACAGTACCTGATCCTG

CAAGGCCCGGATGACG GCGCTCCCATGGCATCATCCATGTCTACTTCCACCTTGGCCAACAGTCTGGCAGCCATTGAAGCCCTGGCTGACGGCCCCACA

TCCACATCTGCATGCCTTGAGCCTCCCGAGGAGCCCCAGGGAGATCCCAGCTCTGTAGCGCAGCAACCCCCAGCTCCTGTCACTGAAGAGCTGGACCTGC

AAAGCTTGGAGGCCATGATGGAGGTGGTGGTTGTGCAACAGTTCAAGTGCAAGATGTGCCAGTACCGGAGCAGCACCAAGGCAACCCTGCTCCGCCACAT

GCGGGAACGGCACTTCCGCCCAG CACTAGCAGCAGCAGCAGCAGCAACTGGTAAAAGGGGCCGTGTACGGAAGTGGGGCACTTCCACCAAGACCACAGA

GGAGGACAGGCCAGAGGAGGAGGAGGAGGACGACGACATCGTGGATGCCGGGGCGATTGACGATCTGGAGG - UNI9742 - AGGACAGTGACTACAA

TCCAGCTGAGGATGAGCCCCGGGGCCGGCAGCTAAGGCTCCAGCGCCCCACACCCAGTACCCCGAGACCTCGACGGAGGCCTGGCCGGCCCCGAAAGCTG

CCTCGCCTAGAGACCTCAGACCTTCATGATG - UNI9989 - GTGTAGGACAGCCTCTAGTGAGTTCGCAGAGCACACAGAGCCCTCCAGAGTTGCAG

GATCTCGAGGCTCCCAGCTCCTCGGGCCTGAGGGCCCTGGGCAAGGTGGGGAGGGGCCTGGTGGAATCAGGCGTTAGTCAGTCGGATGCTGAGAACGCAG

CCCCATCGTGCCAGGATGAAGCTGATGCCCCACCCCGCCGCCGCGGAAGACCTTCCAGGCGGTTCCTAGGGAAGAAATACCGAAA GTACTACTATAAGT

CACCCAAGCCACTGCTCAGGCCTTATCTGTGCCGCATATGTGGCTCACGCTTCCTGTCCCACGAAGACCTTCGCTTCCACGTCAACTCCCATGAGGCTGG

TGACCCACAGCTCTTCAGGTGCCTGCAGTGCAGCTACCGCTCCCGCCGCTGGTCCTCGCTCAAG GAGCACATGTTCAACCACGTGGGCAGCAAGCCCTA

CAAGTGTGACGAGTGCAGCTACACCAGTGTCTACCGCAAGGATGTTATTCGCCACGCGGCTGTGCACAGCCAGGACCG AAAGAAGAGGCCGGATCCG A

CCCCAAAGCTGAGCTCCTTCCCTTGCCCAGTGTGCGGCCGTGTCTACCCCATGCAGAAGAGGCTAACACAGCACATGAAGACTCACAGCACCGAGAAGCC

ACACATGTGCGATAAG TGTGGAAAGTCCTTTAAGAAGCGCTACACCTTCAAAATGCACCTGCTCACACACATCCAGGCCGTTGCCAACCGCAG ATTCA

AGTGTGAGTTCTGCGAGTTTGTTTGTGAGGACAAGAAGGCACTGTTGAACCACCAACTGTCCCACGTGAGCGACAAGCCCTTCAAATGCAGCTTTTGTCC

CTACCGCACCTTCCGCGAGGACTTCCTGCTGTCTCATGTGGCTGTCAAGCACACAG GTGCCAAGCCCTTCGCCTGTGAGTACTGCCACTTCAGCACTCG

CCACAAGAAGAACCTGCGCCTCCACGTAAGATGCCGCCATGCCAACAGCTTTGAGGAGTGGGGACGGCGCCACCCTGAGGAGCCCCCGTCCCGCCGCCGC

CCCTTCTTCTCTCTACAACAGATAGAAGAGCTGAAGCAGCAACACAGCACGGCCCCTGGCCCTCCCCTCAGCTCACCAGGACCCGAG GCCCCCCAAGAA

CCAGCACCTTTCCAGTCACCTGAGACCCCCCCACTACTCTGTCCTGATGCACTAGGTGGCACCACAATCATCTACCAGCAAG GAGCCGAGGAGTCCACT

GCAGTGGCCACTCAGACAGCCTTGGATCTGCTGTTGAATATGAGCGCCCAACGAGAACTGGGGGCCACGGCCTTGCAG GTGGCGGTGGTAAAGTCAGAG

GGCATCGAGGCAGAGTTGACGTCTACTGGTGGGCAACCTTCCCCTGAAGACACCACTCCACGGGTGGTGACACTTCATATGGCAGAATCAGGGAGTAGTG

TGGCAGCTGAGAGCCAGCTAGGCCCATCTGATCTACAGCAGATTGCCTTGCCATCTGGGCCATTTGGTGGGGCCAGCTACAGTGTCATCACGGCACCCCC

AGTGGAGGGGAGGACATCAGCCTCAGGCCCACCTTACAG GGAAGAACCTCCCGGGGAGGCAGCCCAGGCTGTGGTTGTGAGCGACACTCTCAAGGAGGC

TGGCACCCACTACATCATGGCAGCTGATGGGACCCAATTGCACCACATTGAG TTGACTGCAGATGGCTCCATCTCCTTCCCAAGCCCAGATACTCTGGC

CCCTGGAACCAAGTGGCCCCTGCTGCAGTGTGGAGGGCCACCCAGAGATGGTTCTGAGGTTCTGTCTCCAACAAAGACCCACCATATGGGAGGCTCCCAG

GGCTCCTCCACCCCACCCCCTGCAGCCAGCCATACCCTAGGCCTGGTAGTACCCCAATCCCCACCGTCTGCAGCAGCTTCCTCAACAAAGAAGTTTTCCT

GCAAGGTGTGCTCAGAGGCCTTTCCTAGCCGCGCAGAGATGGAGAGTCACAAGCGGGCCCATGCTGGGCCTGCTGCCTTCAAGTGCCCTGACTGCCCCTT

CAGTGCTCGCCAGTGGCCTGAGGTCCGG GCTCACATGGCACAGCACTCAAGCCTGAGGCCCCACCAGTGCAATCAGTGTAGCTTCGCCTCCAAGAACAA

GAAGGATCTGAGGCGGCACATGCTAACGCACACCAACGAGAAGCCATTCTCATGCCACGTCTGCGGGCAGCG TTTCAACAGGAACGGGCACCTCAAATT

CCACATCCAGCGGCTACATAGCATTGATGGGAGAAAGACTGGGACTTCTACAGCCCGAGCCCCAGCCCAGACCATCATCCTCAATAGTGAAGAGGAGACA

CTGGCCACACTACACA CTGCCTTCCAGTCCAGTCACGGGGTTCTGGGTACAGAGCGGCTACAGCAGGCACTGAGCCAAGAACACATCATTGTGGCCCAG

GAACAGACAGTGACCAATCAG GAGGAAGCTACCTACATCCAGGAAATCACAGCAGATGGCCAGACAGTACAGCATCTGGTGACCTCAGACAACCAG GT

TCAGTATATCATCTCTCAGGATGGTGTCCAGCACTTACTGCCTCAGGAGTACGTTGTGGTCCCTGATGGCCATCATATCCAG GTCCAGGAAGGCCAGAT

CACACACATCCAGTATGAGCAAGGTACTCCATTCCTGCAGGAGTCCCAG ATCCAGTATGTACCTGTCTCCCCCAGCCAGCAGCTTGTCACCCAGGCTCA

GCTGGAAGCTGCCGCACACTCCGCTGTCACAG CGGTGGCTGATGCTGCCATGGCCCAAGCCCAGGGCCTGTTTGGCACTGAGGAGGCAGTGCCGGAGCA

GATCCACCAGCTGCAGCATCAGGGCATCGAGTACGACGTCATTACCCTCTCGGATGACTGAGCCTCAAAGGCCCAACGCTGACTGATCGTGGATATCAGG

GGCCGGCTCTCCTGGAGACTAGGGAGTTTCCTGTCCTACTTAGGGCCTCCAGATACTGGACAGTTAGTGTCCCTTGACTCCAAAGGAGCCAGACCTGTGC

TCTTGGGGGGCAGCCAAGGGCTCCAGCCAGGACATGCTGGGTGCCTCAGCCTGCTGGCAGGCTTTGGGAGAGAAATTTATTTTTGTTTTGATGGACCCAC

TGGCTCCTGTCTCAATAAAGGGACCAGAGTCC
Translation
 MEENEVESSSDAAPRPGQPEEPSESGLGVCTSEAVSADSSDAATVPGLTEADDSGVGQSSDGGNHSV - UNI1917 - EEVSESISTDPLPHGCLPD

SSSVSRGPVAEMPGGPPALVHSSVLPDPSMLVSDCTASSSDLGSAIDKIIESTIGPDLIQS SCITVTSGEEGGAETTQYLILQGPDDG GAPMASSMST

STLANSLAAIEALADGPTSTSACLEPPEEPQGDPSSVAQQPPAPVTEELDLQSLEAMMEVVVVQQFKCKMCQYRSSTKATLLRHMRERHFRPA ALAAAA

AATGKRGRVRKWGTSTKTTEEDRPEEEEEDDDIVDAGAIDDLEE - UNI9742 - EDSDYNPAEDEPRGRQLRLQRPTPSTPRPRRRPGRPRKLPRLE

TSDLHDG - UNI9989 - GVGQPLVSSQSTQSPPELQDLEAPSSSGLRALGKVGRGLVESGVSQSDAENAAPSCQDEADAPPRRRGRPSRRFLGKKYR

K KYYYKSPKPLLRPYLCRICGSRFLSHEDLRFHVNSHEAGDPQLFRCLQCSYRSRRWSSLK EHMFNHVGSKPYKCDECSYTSVYRKDVIRHAAVHSQD

R RKKRPDP TPKLSSFPCPVCGRVYPMQKRLTQHMKTHSTEKPHMCDK CGKSFKKRYTFKMHLLTHIQAVANRR RFKCEFCEFVCEDKKALLNHQLS

HVSDKPFKCSFCPYRTFREDFLLSHVAVKHTG GAKPFACEYCHFSTRHKKNLRLHVRCRHANSFEEWGRRHPEEPPSRRRPFFSLQQIEELKQQHSTAP

GPPLSSPGPE APQEPAPFQSPETPPLLCPDALGGTTIIYQQG GAEESTAVATQTALDLLLNMSAQRELGATALQ VAVVKSEGIEAELTSTGGQPSPE

DTTPRVVTLHMAESGSSVAAESQLGPSDLQQIALPSGPFGGASYSVITAPPVEGRTSASGPPYR REEPPGEAAQAVVVSDTLKEAGTHYIMAADGTQLH

HIE LTADGSISFPSPDTLAPGTKWPLLQCGGPPRDGSEVLSPTKTHHMGGSQGSSTPPPAASHTLGLVVPQSPPSAAASSTKKFSCKVCSEAFPSRAEM

ESHKRAHAGPAAFKCPDCPFSARQWPEVR AHMAQHSSLRPHQCNQCSFASKNKKDLRRHMLTHTNEKPFSCHVCGQR RFNRNGHLKFHIQRLHSIDGR

KTGTSTARAPAQTIILNSEEETLATLHT TAFQSSHGVLGTERLQQALSQEHIIVAQEQTVTNQ EEATYIQEITADGQTVQHLVTSDNQ VQYIISQDG

VQHLLPQEYVVVPDGHHIQ VQEGQITHIQYEQGTPFLQESQ IQYVPVSPSQQLVTQAQLEAAAHSAVTA AVADAAMAQAQGLFGTEEAVPEQIHQLQ

HQGIEYDVITLSDD
Transcript ENSMUST00000094343
Sequence
CTCAGCCCTAACACCGGGCAGCATGTGACTTCTAGAGTCCTCCTGGACCCGACGACGGCTCTGAGTCCTCCGAGAGGCCTTCTGAAACCCCGCAGATCTC

TCTCTCCCGGGGGGACGGCGGCGGAAGTAGTTCCGGTTCGAGGGCGGCCGATGGGTTCCTCCGCGACGGGGGTGAGAGGATGGCGACCTCGTCGATGCCG

GAGTCGGAGAGCGACACAGCAGCCAGAGGCTCAG AGTGAAAGCCTCAAACCCCGCGCTTCGCTGTCAGTCGGTCCCCAGAACCAATGGAGGAGAACGAG

GTGGAGAGCAGTAGCGACGCGGCCCCTCGGCCCGGCCAGCCTGAGGAGCCTTCTGAGAGCGGCCTGGGTGTGTGCACCTCGGAAGCTGTGTCCGCGGACA

GCAGCGACGCTGCGACCGTCCCAGGATTAACGGAGGCTGACGACTCTGGCGTCGGGCAGAGCTCGGACGGTGGCAACCACTCTGTG - UNI1917 - G

AGGAGGTATCTGAGAGCATCTCAACAGACCCTTTGCCTCATGGCTGCCTCCCTGATTCATCTTCTGTGTCCCGGGGACCAGTAGCAGAGATGCCTGGTGG

CCCCCCAGCTCTGGTGCATTCCAGTGTTCTCCCAGACCCCAGCATGCTGGTGTCTGACTGCACAGCCTCCTCTTCAGACCTAGGCTCTGCCATTGACAAG

ATCATCGAATCTACCATTGGTCCAGACCTCATCCAGA GCTGCATCACTGTGACCAGTGGTGAAGAGGGAGGAGCTGAGACCACACAGTACCTGATCCTG

CAAGGCCCGGATGACG GCGCTCCCATGGCATCATCCATGTCTACTTCCACCTTGGCCAACAGTCTGGCAGCCATTGAAGCCCTGGCTGACGGCCCCACA

TCCACATCTGCATGCCTTGAGCCTCCCGAGGAGCCCCAGGGAGATCCCAGCTCTGTAGCGCAGCAACCCCCAGCTCCTGTCACTGAAGAGCTGGACCTGC

AAAGCTTGGAGGCCATGATGGAGGTGGTGGTTGTGCAACAGTTCAAGTGCAAGATGTGCCAGTACCGGAGCAGCACCAAGGCAACCCTGCTCCGCCACAT

GCGGGAACGGCACTTCCGCCCAG CACTAGCAGCAGCAGCAGCAGCAACTGGTAAAAGGGGCCGTGTACGGAAGTGGGGCACTTCCACCAAGACCACAGA

GGAGGACAGGCCAGAGGAGGAGGAGGAGGACGACGACATCGTGGATGCCGGGGCGATTGACGATCTGGAGG - UNI9742 - AGGACAGTGACTACAA

TCCAGCTGAGGATGAGCCCCGGGGCCGGCAGCTAAGGCTCCAGCGCCCCACACCCAGTACCCCGAGACCTCGACGGAGGCCTGGCCGGCCCCGAAAGCTG

CCTCGCCTAGAGACCTCAGACCTTCATGATG - UNI9989 - GTGTAGGACAGCCTCTAGTGAGTTCGCAGAGCACACAGAGCCCTCCAGAGTTGCAG

GATCTCGAGGCTCCCAGCTCCTCGGGCCTGAGGGCCCTGGGCAAGGTGGGGAGGGGCCTGGTGGAATCAGGCGTTAGTCAGTCGGATGCTGAGAACGCAG

CCCCATCGTGCCAGGATGAAGCTGATGCCCCACCCCGCCGCCGCGGAAGACCTTCCAGGCGGTTCCTAGGGAAGAAATACCGAAA GTACTACTATAAGT

CACCCAAGCCACTGCTCAGGCCTTATCTGTGCCGCATATGTGGCTCACGCTTCCTGTCCCACGAAGACCTTCGCTTCCACGTCAACTCCCATGAGGCTGG

TGACCCACAGCTCTTCAGGTGCCTGCAGTGCAGCTACCGCTCCCGCCGCTGGTCCTCGCTCAAG GAGCACATGTTCAACCACGTGGGCAGCAAGCCCTA

CAAGTGTGACGAGTGCAGCTACACCAGTGTCTACCGCAAGGATGTTATTCGCCACGCGGCTGTGCACAGCCAGGACCG AAAGAAGAGGCCGGATCCG A

CCCCAAAGCTGAGCTCCTTCCCTTGCCCAGTGTGCGGCCGTGTCTACCCCATGCAGAAGAGGCTAACACAGCACATGAAGACTCACAGCACCGAGAAGCC

ACACATGTGCGATAAG ATTCAAGTGTGAGTTCTGCGAGTTTGTTTGTGAGGACAAGAAGGCACTGTTGAACCACCAACTGTCCCACGTGAGCGACAAGC

CCTTCAAATGCAGCTTTTGTCCCTACCGCACCTTCCGCGAGGACTTCCTGCTGTCTCATGTGGCTGTCAAGCACACAG GTGCCAAGCCCTTCGCCTGTG

AGTACTGCCACTTCAGCACTCGCCACAAGAAGAACCTGCGCCTCCACGTAAGATGCCGCCATGCCAACAGCTTTGAGGAGTGGGGACGGCGCCACCCTGA

GGAGCCCCCGTCCCGCCGCCGCCCCTTCTTCTCTCTACAACAGATAGAAGAGCTGAAGCAGCAACACAGCACGGCCCCTGGCCCTCCCCTCAGCTCACCA

GGACCCGAG GCCCCCCAAGAACCAGCACCTTTCCAGTCACCTGAGACCCCCCCACTACTCTGTCCTGATGCACTAGGTGGCACCACAATCATCTACCAG

CAAG GAGCCGAGGAGTCCACTGCAGTGGCCACTCAGACAGCCTTGGATCTGCTGTTGAATATGAGCGCCCAACGAGAACTGGGGGCCACGGCCTTGCAG

 GTGGCGGTGGTAAAGTCAGAGGGCATCGAGGCAGAGTTGACGTCTACTGGTGGGCAACCTTCCCCTGAAGACACCACTCCACGGGTGGTGACACTTCAT

ATGGCAGAATCAGGGAGTAGTGTGGCAGCTGAGAGCCAGCTAGGCCCATCTGATCTACAGCAGATTGCCTTGCCATCTGGGCCATTTGGTGGGGCCAGCT

ACAGTGTCATCACGGCACCCCCAGTGGAGGGGAGGACATCAGCCTCAGGCCCACCTTACAG GGAAGAACCTCCCGGGGAGGCAGCCCAGGCTGTGGTTG

TGAGCGACACTCTCAAGGAGGCTGGCACCCACTACATCATGGCAGCTGATGGGACCCAATTGCACCACATTGAG TTGACTGCAGATGGCTCCATCTCCT

TCCCAAGCCCAGATACTCTGGCCCCTGGAACCAAGTGGCCCCTGCTGCAGTGTGGAGGGCCACCCAGAGATGGTTCTGAGGTTCTGTCTCCAACAAAGAC

CCACCATATGGGAGGCTCCCAGGGCTCCTCCACCCCACCCCCTGCAGCCAGCCATACCCTAGGCCTGGTAGTACCCCAATCCCCACCGTCTGCAGCAGCT

TCCTCAACAAAGAAGTTTTCCTGCAAGGTGTGCTCAGAGGCCTTTCCTAGCCGCGCAGAGATGGAGAGTCACAAGCGGGCCCATGCTGGGCCTGCTGCCT

TCAAGTGCCCTGACTGCCCCTTCAGTGCTCGCCAGTGGCCTGAGGTCCGG GCTCACATGGCACAGCACTCAAGCCTGAGGCCCCACCAGTGCAATCAGT

GTAGCTTCGCCTCCAAGAACAAGAAGGATCTGAGGCGGCACATGCTAACGCACACCAACGAGAAGCCATTCTCATGCCACGTCTGCGGGCAGCG TTTCA

ACAGGAACGGGCACCTCAAATTCCACATCCAGCGGCTACATAGCATTGATGGGAGAAAGACTGGGACTTCTACAGCCCGAGCCCCAGCCCAGACCATCAT

CCTCAATAGTGAAGAGGAGACACTGGCCACACTACACA CTGCCTTCCAGTCCAGTCACGGGGTTCTGGGTACAGAGCGGCTACAGCAGGCACTGAGCCA

AGAACACATCATTGTGGCCCAGGAACAGACAGTGACCAATCAG GAGGAAGCTACCTACATCCAGGAAATCACAGCAGATGGCCAGACAGTACAGCATCT

GGTGACCTCAGACAACCAG GTTCAGTATATCATCTCTCAGGATGGTGTCCAGCACTTACTGCCTCAGGAGTACGTTGTGGTCCCTGATGGCCATCATAT

CCAG GTCCAGGAAGGCCAGATCACACACATCCAGTATGAGCAAGGTACTCCATTCCTGCAGGAGTCCCAG ATCCAGTATGTACCTGTCTCCCCCAGCC

AGCAGCTTGTCACCCAGGCTCAGCTGGAAGCTGCCGCACACTCCGCTGTCACAG CGGTGGCTGATGCTGCCATGGCCCAAGCCCAGGGCCTGTTTGGCA

CTGAGGAGGCAGTGCCGGAGCAGATCCACCAGCTGCAGCATCAGGGCATCGAGTACGACGTCATTACCCTCTCGGATGACTGAGCCTCAAAGGCCCAACG

CTGACTGATCGTGGATATCAGGGGCCGGCTCTCCTGGAGACTAGGGAGTTTCCTGTCCTACTTAGGGCCTCCAGATACTGGACAGTTAGTGTCCCTTGAC

TCCAAAGGAGCCAGACCTGTGCTCTTGGGGGGCAGCCAAGGGCTCCAGCCAGGACATGCTGGGTGCCTCAGCCTGCTGGCAGGCTTTGGGAGAGAAATTT

ATTTTTGTTTTGATGGACCCACTGGCTCCTGTCTCAATAAAGGGACCAGAGTCC
Translation
 MEENEVESSSDAAPRPGQPEEPSESGLGVCTSEAVSADSSDAATVPGLTEADDSGVGQSSDGGNHSV - UNI1917 - EEVSESISTDPLPHGCLPD

SSSVSRGPVAEMPGGPPALVHSSVLPDPSMLVSDCTASSSDLGSAIDKIIESTIGPDLIQS SCITVTSGEEGGAETTQYLILQGPDDG GAPMASSMST

STLANSLAAIEALADGPTSTSACLEPPEEPQGDPSSVAQQPPAPVTEELDLQSLEAMMEVVVVQQFKCKMCQYRSSTKATLLRHMRERHFRPA ALAAAA

AATGKRGRVRKWGTSTKTTEEDRPEEEEEDDDIVDAGAIDDLEE - UNI9742 - EDSDYNPAEDEPRGRQLRLQRPTPSTPRPRRRPGRPRKLPRLE

TSDLHDG - UNI9989 - GVGQPLVSSQSTQSPPELQDLEAPSSSGLRALGKVGRGLVESGVSQSDAENAAPSCQDEADAPPRRRGRPSRRFLGKKYR

K KYYYKSPKPLLRPYLCRICGSRFLSHEDLRFHVNSHEAGDPQLFRCLQCSYRSRRWSSLK EHMFNHVGSKPYKCDECSYTSVYRKDVIRHAAVHSQD

R RKKRPDP TPKLSSFPCPVCGRVYPMQKRLTQHMKTHSTEKPHMCDK IQV              

For any suggestions or comments, please send an email to unitrap@crg.es