Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000039835 (Nhsl1)
Chromosomal location
Chr 10: 18127481 - 18253695 (+)
Description
NHS-like 1 Gene [Source:MGI Symbol;Acc:MGI:106390]
RefSeq_dna
NM_173390 
RefSeq_peptide
NP_775566.3 
UniGene
Mm.410725 Mm.436392 Mm.297971 
MGI
MGI:106390 
Uniprot/SWISSPROT
Q8CAF4 
Human Ortholog
ENSG00000135540 (NHSL1)
Omim not available
UniTrap UNI30916
Vector Insertion
Chr 10: 18128321 - 18189913
Public Clones (ggtc) IST12736H12 (tigm) IST11565G10 (tigm) IST11295C1 (tigm) IST12233H8 (tigm)
IST14930D12 (tigm) IST14741E3 (tigm) IST14733E1 (tigm) IST14619B9 (tigm)
IST14106B8 (tigm) IST12667A10 (tigm) IST11295C2 (tigm) IST10722H12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15877
Vector Insertion
Chr 10: 18189972 - 18192724
Public Clones not available
Private Clones OST471184 (lexicon) OST375229 (lexicon) OST320731 (lexicon) OST274655 (lexicon)
OST234413 (lexicon) OST35812 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31185
Vector Insertion
Chr 10: 18231549 - 18235834
Public Clones IST11364A7 (tigm) IST11618F1 (tigm) IST14501C1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000100054
Sequence
ATGGTGGTCTTCATTAATGCAAAGATTAAATCTTTCTTTAAACTTTTTAAAAAGAAAA - UNI15877 - CGGTTTCCAACTTGGACGAGGAGAGTCG

ATGGACTGTCCACTACACGGCACCATGGCATCAGCAAGAGAATGTGTTCCTTCCCGCCACAAGACCCCCCTGTGTTGAGGACCTGCACCGCCAAGCCAAG

CTCAACCTCAAATCAGTGCTGAGGG AATGTGACAAGCTGAGGCAAGATGGCTGCCGAAGTTCTCAGTACTATTCTCAGGGACCCACCTTTGCAGCCGGC

TCCAGCCCCTGCGACGATTATCAAGATGAAGACACAGAAGCAGACCGAAAG TGCTCTCTCTCTTCATCTGAAGAAGAAAGATTTATCGGAATCAGGAGA

CCTAAAACGCCAACCTCAGGTGACTTCTCCGACCTTCATACTCAGACAAACTGGACCAAGTCCCTGCCGCTGCCAACACCAGAAGAGAAGACGCGGCAGC

AAGCCCAGACGGTCCAGGCTGACGTGGTTCCTATAAACATAACTG - UNI31185 - GGGAGAATTTCGATCGTCAGGCCAGCCTTCGGCGGTCTCTA

ATTTACACAGACACTCTGGTAAGACGACCGAAGAAAGTCAAAAGGAGAAAGACAATTTCAGGAATCCCTGACATCATTCAGAAGGAGCTAG CATCAGCC

ACTGGCCAAGATGATGATGGTAGTGCCCATTCGCTGTACGTCCCAGACCACTACTCTACGTTAGGAAGGCTTGATAGTTATCGGTCCACCGGGCAATGCT

TGGAAACCAGGGACACCAGCTGTCAGACCGAAGACGTGAAGGTCATCCCACCATCAATGAGAAGGATCAGGGCTCACAAGGGGGTAGGCGTTGCTGCCCA

GATGAGCCACCTCTCAGGTTCCTCAGGCAACATGTCTGTGCTGAGTGACTCAGCCGGTGTTGTGTTCCCATCTCGCCTCAGTAACGATACTGGTTTCCAC

AGTCTTCCACGTACCGGCCCGAGAGCAAGCACCTATTCACTGGAGGGAAGGATGGGTGCCCTGGGCTCTACTGAAGATACGGATGACACTTCTCCCTACC

AGGGGGGTAGCTTACAGGGGCATGAAAACTTTGCGCATTTAGGAGGTGCGTCGAGTACTGGGATGCTTTCGAGGCCCAAATCCCAGCAGTTGAGGTTTTT

GGAGAGTCCAGCATGTGTGGTTTCACCTCATGCAGCCTACTCTACCAGTGTCATCCCAAATGCCACGCTACTGTCCTCTTCAGAGGTTATTGTCATTCAC

ACTGCTCAGAGTGCAGGACAGCTGGACAGTAGAACACCCGGTTCATCTTCATATTCAAAAATAAAACCCAGAGACCGTCCCACACCCAGATGTTCTGTGA

AAGATGACCATCAGTCCCCCCGTCATCACTGGAACGAGGGTCATCTCATTCATTCACGGGCTTTAGCCTCCTCTGTCCCTGGTGCCACCACGCTGTTATC

CCTCCATGATTCAGAGGTCTCTCTAAATGCCCCAGCAAACAGGGAAAATGGATCCCAAGCCATACTCTATCATTGTAGAAACAACCCAAGCTTTCCTGAC

CACCCTTCAGATGTGGATGGCAAGAGCGAGTGTAGTTATTCGGGGGACAGGGGATGTGGCAGTTCTGAGCCCTGGGAATATAAAACCTCCAGCAATGGGC

GGGCATCCCCACTGAAGCCACACCTGGCCACTCCTGGTTGCTCTACTCCCACAAGTAACGTGAGCAGCTGCAGTTTGGACCAAACATCTCTCAAGGGTGA

TACCAGGTCCCTGTGTTCAGAGGACCATGATGGTTACTATACTACCACTCACGAGGCTGGGAACCTGTACACTCTCAGTGATGGCTTGGGGAACCCCAGG

CACAGCATGGTCAATGTTTTTGATGGAAGGGCTCAGAGAAGCCAAGGGGATCAGGCCGCTCACCAGGATAAAATCCTTTCGAGAAACATCTCTCTGAAGA

AAGCAAAGAAACCACCCCTGCCACCATCCCGGACCGATTCTCTGCGAAGGATTCCCAAAAAGAACAACCAGACAAACGGTCAGGTGCTCAATGAGAGCCT

GATCGCCTCGCTCCAGCATTCACTGCAGCTAAGCCTCCCTGGCAAGGGCGGCAGCTCCCCTTCCCAGAGCCCCTGCAGTGACTTTGAGGAACCCTGGCTC

CCCAGGTCCAGAAGCCAGAGCATTGTTAGCGAGGGTAGTAGCTTGACCTCCACCACCACTCCCAACGTGTATTCTCTGTGTGGGGTCACTCCGTCCCAGA

GCGACACAAGTAGCGTCAAGTCGGAATACACGGACCCTTGGGGTTACTACATTGACTACACGAGCTTGCAGGAAGATCCAGGGAACCCCACCGGGGGCTG

CTCAGCCAACACTGAGGCAGCAACTGGAAACGGGCCAGTACGCCACATCCAGGAGGGGTCGAGAGTCCCAGTGCCCCAAGTGCCGGGCTGCTCAGTTAGA

CCAAAGATCGCCTCACCAGAGAAGTCACAGAGAGTCACCTCTCCATCCAGTGGGTATTCTAGCCAGTCGAATACACCCACAGCACTCACCCCTGTGCCTG

TGTTTTTAAAATCAATGTCACCAGCAAATGGAAAGGGGAAGGCCAAGCCCAAGGTACCAGAAAGAAAATCGTCTCTGATCTCTTCTATGTCCATCTCATC

ATCGTCCACTTCTCTCTCTTCTAATACTTCTACCGAAGGAAGTGGGACCATGAAGAAACTGGATACAACCCTGGCCTCGGCCCTTGCCCCTCCCCCTCCT

CCTCTTCCCCCTCTGCCTTCTCCGTGTCTGGCAGACAAGTCCCCTTTTCTTCCACCACCTCCTCCTCTAGCAGATTGCTCCGAGGGCTCTCCTCTGCCGC

CCTCTCCCATGTTCCCCCCTCCACCACCAGAAGCCCTTGTTCCCTTCTGCTCCCCCACCGACGGGTGCCTTTCTCCTTCTCCCACAGCAGTTAGCCCCTC

TCTTCCAAGATCCTTGCCTCCTGTGCCAGCACCTCCACCTTTCTTGCCCTCATCAGAACCCCCGCCCGCTCCGCCTCTGGACCCCAAACTCATGAAAGAA

AACAGGCCCTTTTTCAAAAACTCTAGCCAGTCCGAATCCTCTAGGGAGGCCCTCAGGCGGCCTGCCAACAAGGAGGAGGGCTGCCGACCCCCCATGCCCC

TGATCACCACAGAAGCTTTGCAGATGGTGCAGTTGAGGCCAGTGAGGAAGAACTCAGGTGCCGGGGCAGTCCTGTTTTCTGAACCATCAGCTCAGGAACA

ACGAACTCCGACTGCTCCACAGTATCACTTAAAGCCATCTGCTTTCCTCAAATCCCGAAATAGCATAAATGAAATGGAGAGTGAAAGCCAGGCTGCCTCT

GTGACGAGCTCGCTTCCGATGCCTGCCAAGAGCCAGAGTCAGGGTGACCATGACAGTGCAGTAGAGCGTGGCGGCCTTCCGAGCTGCAGCGATGGAGCTC

CAGGCCCGGGTCCCAGCCTCAGGACCACTCTGCTCCCAGACTCTTCACCCAGCAGGAAGCCACCCCCCATCTCTAAGAAGCCCAAACTGTTCCTGGTGGT

ACCACCTCCGCAGAGAGATTTCACAGCGGAGCCCACAGAGAACGGGAGCGAAGCTTTCCCAGGCGTGCCCAGCCCTACCAGGGCAGAGGGGGAAGCTGTG

CGGAGCCAAGAGGAGAAATCCAGCCCAGCATCCCGAGCTGGCTCTCATGCTACGGCCCCCACCCCCGGCAGTCCGGCTCTAGAACCGGGAACTGCAGGGT

CCTTATCCTCTAGCATTGTGGAAGCCAATGTCCCCATGGTCCAACCTAATACATCACCGGGCCCCACACAGGAAGAGTCAGGCGAGAACAGTGTGGATGG

TGAGAGAAATGCGAAGAGCTGCCTGTCTCAACAGGGCAGAGAAG CTGGCTTGCTGGAACCCAACACAGCTGCTTCCTCTTCAGACCCCGTGGATGTATC

TAAGGAAGAGGGAAGCGATGAGGTGCTGACTCCGACTAAACCCAGGACAACAGAAGACCTGTTTGCAGCCATTCACAG ATCTAAAAGGAAAGTCCTTGG

CCGGAAAGACTCAGAAGACGATCACACTCGAAATCACTCTCCCTCCCCGCCTGTGACACCCACGAGTGCTGCCCCTAACCTGGCCTCTCCAAAGCAAGTA

GGGTCTATCCAGAGAAGCATAAAAAAGAGCACTACCAGCAGTGACAACTTCAAAGCTCTGCTGCTAAAGAAGGGGAGTCGCTCGGACACCAGCGCTCGCA

TGTCAGCGGCTGAGATGCTCAAGTCTACGGACCCTCGCTTCCAGAGATCTAGGTCGGAGCCTTCGGCAGACAGCCCGGACAGCCCATCCAGCTGCTCCCC

CAACAAGAACAGGAGAGCTCAGGAAGAGTGGGCCAAGAACGAAGGCCTGATGCCTCGGAGTCTGTCCTTTTCGGGCCCTCGGTACAGCCGCAGCAGGACG

CCACCCTCTGCGGCCAGCAGCAGGTACAGCATGCGGAACCGCATCCAGAGCAGCCCCATGACCGTCATCTCCGAGGGAGAGGGAGAACCTGCTGAGCCAG

CGGACAACAAAGCACGCAGGGCCCTGGATGCTACCAGGGTGTGCTCTCTGGACAGACTGACGGGTCAGGAGATGGACCAGGCCAGCCTCCTCTGTAGCGA

GGAGCCTGCCTCTGTGGATGGGATAGGAAGGGCTGAGGGCAACGGTCCCTCGGAGCAGTGTGGGGGTACGGAACAGAAGAGTTAGTATCAGAGCCTGCCT

CTCATGAGTGAGGCAGGAAGGTGAGCTGTGCATCACTCTAGGAAGTCTCTGTGGCCTTTTCCTGGCTTGTGGGGACCCCACTCAGCATTGGTGTTGGGGA

GGTCTCGGCCTTTCGGGTCTCTTAGGACTCACTCGCCGTGTGGCTTAAAAGCAAGTAGAAGCTTCAACTTCTGAAAGTGCTTCCTGGGGAAGATGGTTTG

CTTTTGTTGTTTTGTTTTGTTTTTCCCAAAATGCTGGGTGTGTGTATATGTGTGAATTTTGAGTACTTCATTCTAACAAATACACACACTAACGTTACGT

ATAGAAATAGGAGAAAAGGTCAGAGTTCAGGTAGGGTAATGGAGTCCACTAGACCAGGGTGATAAGTGGTTTCAGCGCATTACGGGTGTGGGAATGTGTA

AGTTCACGAAGAGACTGGAAGCCGTTAGTGGGCTGGTTCTAAGTATAGAACATGTCTGTGTGTGCACTTACTCAAGACACACGGGAAACCAGGAAGGGGC

TGGGAAGTGGCTAAGCAACTCATTGGTTCAGGTACTTTAGGGGGCGGGGAGGCCTTGGTGCAGCTGCCGCCTCCTCCTCCTCCCCCTCCTCCTCCGCTTG

TAAAAATTACACAAATGGAAGTGGCAAGGCTGTGTCCTGTGCCTACTGCATACATTTCTAGCCTTGGTGTCAGAAGCATGGGTGGGTTTTTAGTTTGTTG

GCTTTTTTTTTTTTTTTAAATGAATTCCTTCCTGGAGTTGTTAATGAAGAATGAAGGAAGAGAGGCATCGTGAGAGAAGGGTAGGGGAGTGATTAATACT

GCTGGATTTGTTTCCTGCTTATTAAATAAAATATTTTCACAATTAAATCAGAAAACATGCACTGTAGAATTATAGGTGAAGCTTTTCTTTTAAAGAGTCG

TTTTGTTTTACAATCAGAGTTTTAACTTCCATGTGACAGTTTGTCACTTGAAATGTGACACCTGGCATTTTCTAACTTTTGGCTATACCAAAGAAAAATA

ATATGGCTATTTTTCACCCCTGAACTGCTTACAGCATCTTGTTTTAATTTAGAAGGGTTTACCAAAATCTATTATATATTATCTCCCTTTGAAGAAAACG

GTGACTCTAGTCAGTGACAGAAATTGCTGAAAATCGGTAGGGCATGGCTATGAACTAGCCCTGGGAAATGAGTTTTTAGATTAAAAAGATTTTTTTTTCT

TTTGCACAGCCTGGTTTGTATGATTTTATATTTGTTTATGAGTTGAGTTGCTGAGTCCCTTCGAGGCTCCTCCCATCAGAATTGCAAATGTGCTTTAGAA

CCGGGATTAGAGTGTACAACCGTATTTATTTTAATATCACCTCCTTGGGCTCCTTGCCCACTCCCAGGTTCCGTGTATCCAGCCGAAGCGCACGCTACCT

TAGTCTCCCAGTGGCTACACTGACCTTCTAAAGCTGCTGGCAGTGGCCATTGACAATGTGTGACAGTGTCTGGAAGTCAAGCCACACAAGCCAAAGCATC

CAAGACTTCTTCCACAGAACCTTTGATAGCCATTTCAGATACATCTCTGAGGAGAGAATCTAGCAAACAAAGCACGCCTCACAGCCGCAAATGATGACCT

GACATGTGGCCTCAGAGATTTGTTTTTTTTTTTTTCCTAAATCCGCTGTGTCACTTTTCAACTGTGTGGGCACACAGATCATCTCCTGTAAATCTTAGGC

CATGTTGACATTTGAATACCTAAAAAAGATTAGAATGTATGTGGATATCAGAAATCTTAAACTTAATATATCAATATTTGTTTGAAGGTAAGATAAGCAG

CATTAGAACTAATTATAAAATGATTTTAAATCCCTCATTTAAAAGGTATTTATTAGGTTTTAAGTTTGTTTTCAATAAAACAATTGTAAAGCCAATATTT

G
Translation
MVVFINAKIKSFFKLFKKKT - UNI15877 - TVSNLDEESRWTVHYTAPWHQQENVFLPATRPPCVEDLHRQAKLNLKSVLRE ECDKLRQDGCRSS

QYYSQGPTFAAGSSPCDDYQDEDTEADRK CSLSSSEEERFIGIRRPKTPTSGDFSDLHTQTNWTKSLPLPTPEEKTRQQAQTVQADVVPINITG - UN

I31185 - GENFDRQASLRRSLIYTDTLVRRPKKVKRRKTISGIPDIIQKELA ASATGQDDDGSAHSLYVPDHYSTLGRLDSYRSTGQCLETRDTSCQ

TEDVKVIPPSMRRIRAHKGVGVAAQMSHLSGSSGNMSVLSDSAGVVFPSRLSNDTGFHSLPRTGPRASTYSLEGRMGALGSTEDTDDTSPYQGGSLQGHE

NFAHLGGASSTGMLSRPKSQQLRFLESPACVVSPHAAYSTSVIPNATLLSSSEVIVIHTAQSAGQLDSRTPGSSSYSKIKPRDRPTPRCSVKDDHQSPRH

HWNEGHLIHSRALASSVPGATTLLSLHDSEVSLNAPANRENGSQAILYHCRNNPSFP  
Transcript ENSMUST00000037341
Sequence
ATTGTTTGTGGAGTCCTGCGGCTAGGAGCGCTTCCCAGACGGGAAGGAGGGCAAGTGGGCGGTTTATGATTCTTCCCTGGGCCGGGACAACAGAGCCGAA

CCCTTTGATTTCTCCTGAGTAACCTGTGTGGGTGAACTTTAAACTAGGGGCCTGCTTGACGCTGGATCTTTTTCTGCAGGGTGAGGAGTTAGCTCCGGAA

GCCTGGCTGTCTGCCTTAAGAGGGAAAGATGCCCTGGAGAGGCGTAGGATTACCTTTAGGGATGCTAGCCATGCAGCCAAGAGTCGGGGTACCTTGGCTC

TTCTTCACAAAGTCTTGGCAAGTGTGTCTGAAATGACTGTACTGTTTATTTTTCTAAAGCTTGTACTTCTATTTATTATTATTTTTATTTTTGCCTGAGG

ACCTCCCGCCAGAAATTGGTGCTACAATGTGTCTAGAGTAAACCATTTTCTTAAAAAATTTATCTTTAATCCTTCATTTTCCTTTTAATCGGGCACGCAG

AAGCACAAAGCCTGCCCGACTCTCAGCGTTAAGAGGGAAGGGGCAGGCCCCTTTCAAGGATCCCGGCCAATTCTAAAAAGCCAGCATTTTGTTTGTTGGG

CTGCCCTTTGTCTCTAGAGGATTTTGATGTGAAAGAAGATGAAAAAGGACGGCTCCTCAGGTTCCTTCGGAATCAAGGCAAGCCCAGGCTCCCTCTCACG

TGCTGTGAGTTGGATAAATTTCTCCTCCCTGTCCAGGCAGACAAAGAGGCTGTTCCGCAGTGATGGAGAGCTGTCCGTTTGTGGGCACCAGGTGGAAGCC

GATGATGAGAACTGGATATACAGGACCCAGCCCAGAAAAG - UNI15877 - - UNI30916 - CGGTTTCCAACTTGGACGAGGAGAGTCGATGGA

CTGTCCACTACACGGCACCATGGCATCAGCAAGAGAATGTGTTCCTTCCCGCCACAAGACCCCCCTGTGTTGAGGACCTGCACCGCCAAGCCAAGCTCAA

CCTCAAATCAGTGCTGAGGG AATGTGACAAGCTGAGGCAAGATGGCTGCCGAAGTTCTCAGTACTATTCTCAGGGACCCACCTTTGCAGCCGGCTCCAG

CCCCTGCGACGATTATCAAGATGAAGACACAGAAGCAGACCGAAAG TGCTCTCTCTCTTCATCTGAAGAAGAAAGATTTATCGGAATCAGGAGACCTAA

AACGCCAACCTCAGGTGACTTCTCCGACCTTCATACTCAGACAAACTGGACCAAGTCCCTGCCGCTGCCAACACCAGAAGAGAAGACGCGGCAGCAAGCC

CAGACGGTCCAGGCTGACGTGGTTCCTATAAACATAACTG - UNI31185 - CATCAGCCACTGGCCAAGATGATGATGGTAGTGCCCATTCGCTGTA

CGTCCCAGACCACTACTCTACGTTAGGAAGGCTTGATAGTTATCGGTCCACCGGGCAATGCTTGGAAACCAGGGACACCAGCTGTCAGACCGAAGACGTG

AAGGTCATCCCACCATCAATGAGAAGGATCAGGGCTCACAAGGGGGTAGGCGTTGCTGCCCAGATGAGCCACCTCTCAGGTTCCTCAGGCAACATGTCTG

TGCTGAGTGACTCAGCCGGTGTTGTGTTCCCATCTCGCCTCAGTAACGATACTGGTTTCCACAGTCTTCCACGTACCGGCCCGAGAGCAAGCACCTATTC

ACTGGAGGGAAGGATGGGTGCCCTGGGCTCTACTGAAGATACGGATGACACTTCTCCCTACCAGGGGGGTAGCTTACAGGGGCATGAAAACTTTGCGCAT

TTAGGAGGTGCGTCGAGTACTGGGATGCTTTCGAGGCCCAAATCCCAGCAGTTGAGGTTTTTGGAGAGTCCAGCATGTGTGGTTTCACCTCATGCAGCCT

ACTCTACCAGTGTCATCCCAAATGCCACGCTACTGTCCTCTTCAGAGGTTATTGTCATTCACACTGCTCAGAGTGCAGGACAGCTGGACAGTAGAACACC

CGGTTCATCTTCATATTCAAAAATAAAACCCAGAGACCGTCCCACACCCAGATGTTCTGTGAAAGATGACCATCAGTCCCCCCGTCATCACTGGAACGAG

GGTCATCTCATTCATTCACGGGCTTTAGCCTCCTCTGTCCCTGGTGCCACCACGCTGTTATCCCTCCATGATTCAGAGGTCTCTCTAAATGCCCCAGCAA

ACAGGGAAAATGGATCCCAAGCCATACTCTATCATTGTAGAAACAACCCAAGCTTTCCTGACCACCCTTCAGATGTGGATGGCAAGAGCGAGTGTAGTTA

TTCGGGGGACAGGGGATGTGGCAGTTCTGAGCCCTGGGAATATAAAACCTCCAGCAATGGGCGGGCATCCCCACTGAAGCCACACCTGGCCACTCCTGGT

TGCTCTACTCCCACAAGTAACGTGAGCAGCTGCAGTTTGGACCAAACATCTCTCAAGGGTGATACCAGGTCCCTGTGTTCAGAGGACCATGATGGTTACT

ATACTACCACTCACGAGGCTGGGAACCTGTACACTCTCAGTGATGGCTTGGGGAACCCCAGGCACAGCATGGTCAATGTTTTTGATGGAAGGGCTCAGAG

AAGCCAAGGGGATCAGGCCGCTCACCAGGATAAAATCCTTTCGAGAAACATCTCTCTGAAGAAAGCAAAGAAACCACCCCTGCCACCATCCCGGACCGAT

TCTCTGCGAAGGATTCCCAAAAAGAACAACCAGACAAACGGTCAGGTGCTCAATGAGAGCCTGATCGCCTCGCTCCAGCATTCACTGCAGCTAAGCCTCC

CTGGCAAGGGCGGCAGCTCCCCTTCCCAGAGCCCCTGCAGTGACTTTGAGGAACCCTGGCTCCCCAGGTCCAGAAGCCAGAGCATTGTTAGCGAGGGTAG

TAGCTTGACCTCCACCACCACTCCCAACGTGTATTCTCTGTGTGGGGTCACTCCGTCCCAGAGCGACACAAGTAGCGTCAAGTCGGAATACACGGACCCT

TGGGGTTACTACATTGACTACACGAGCTTGCAGGAAGATCCAGGGAACCCCACCGGGGGCTGCTCAGCCAACACTGAGGCAGCAACTGGAAACGGGCCAG

TACGCCACATCCAGGAGGGGTCGAGAGTCCCAGTGCCCCAAGTGCCGGGCTGCTCAGTTAGACCAAAGATCGCCTCACCAGAGAAGTCACAGAGAGTCAC

CTCTCCATCCAGTGGGTATTCTAGCCAGTCGAATACACCCACAGCACTCACCCCTGTGCCTGTGTTTTTAAAATCAATGTCACCAGCAAATGGAAAGGGG

AAGGCCAAGCCCAAGGTACCAGAAAGAAAATCGTCTCTGATCTCTTCTATGTCCATCTCATCATCGTCCACTTCTCTCTCTTCTAATACTTCTACCGAAG

GAAGTGGGACCATGAAGAAACTGGATACAACCCTGGCCTCGGCCCTTGCCCCTCCCCCTCCTCCTCTTCCCCCTCTGCCTTCTCCGTGTCTGGCAGACAA

GTCCCCTTTTCTTCCACCACCTCCTCCTCTAGCAGATTGCTCCGAGGGCTCTCCTCTGCCGCCCTCTCCCATGTTCCCCCCTCCACCACCAGAAGCCCTT

GTTCCCTTCTGCTCCCCCACCGACGGGTGCCTTTCTCCTTCTCCCACAGCAGTTAGCCCCTCTCTTCCAAGATCCTTGCCTCCTGTGCCAGCACCTCCAC

CTTTCTTGCCCTCATCAGAACCCCCGCCCGCTCCGCCTCTGGACCCCAAACTCATGAAAGAAAACAGGCCCTTTTTCAAAAACTCTAGCCAGTCCGAATC

CTCTAGGGAGGCCCTCAGGCGGCCTGCCAACAAGGAGGAGGGCTGCCGACCCCCCATGCCCCTGATCACCACAGAAGCTTTGCAGATGGTGCAGTTGAGG

CCAGTGAGGAAGAACTCAGGTGCCGGGGCAGTCCTGTTTTCTGAACCATCAGCTCAGGAACAACGAACTCCGACTGCTCCACAGTATCACTTAAAGCCAT

CTGCTTTCCTCAAATCCCGAAATAGCATAAATGAAATGGAGAGTGAAAGCCAGGCTGCCTCTGTGACGAGCTCGCTTCCGATGCCTGCCAAGAGCCAGAG

TCAGGGTGACCATGACAGTGCAGTAGAGCGTGGCGGCCTTCCGAGCTGCAGCGATGGAGCTCCAGGCCCGGGTCCCAGCCTCAGGACCACTCTGCTCCCA

GACTCTTCACCCAGCAGGAAGCCACCCCCCATCTCTAAGAAGCCCAAACTGTTCCTGGTGGTACCACCTCCGCAGAGAGATTTCACAGCGGAGCCCACAG

AGAACGGGAGCGAAGCTTTCCCAGGCGTGCCCAGCCCTACCAGGGCAGAGGGGGAAGCTGTGCGGAGCCAAGAGGAGAAATCCAGCCCAGCATCCCGAGC

TGGCTCTCATGCTACGGCCCCCACCCCCGGCAGTCCGGCTCTAGAACCGGGAACTGCAGGGTCCTTATCCTCTAGCATTGTGGAAGCCAATGTCCCCATG

GTCCAACCTAATACATCACCGGGCCCCACACAGGAAGAGTCAGGCGAGAACAGTGTGGATGGTGAGAGAAATGCGAAGAGCTGCCTGTCTCAACAGGGCA

GAGAAG CTGGCTTGCTGGAACCCAACACAGCTGCTTCCTCTTCAGACCCCGTGGATGTATCTAAGGAAGAGGGAAGCGATGAGGTGCTGACTCCGACTA

AACCCAGGACAACAGAAGACCTGTTTGCAGCCATTCACAG ATCTAAAAGGAAAGTCCTTGGCCGGAAAGACTCAGAAGACGATCACACTCGAAATCACT

CTCCCTCCCCGCCTGTGACACCCACGAGTGCTGCCCCTAACCTGGCCTCTCCAAAGCAAGTAGGGTCTATCCAGAGAAGCATAAAAAAGAGCACTACCAG

CAGTGACAACTTCAAAGCTCTGCTGCTAAAGAAGGGGAGTCGCTCGGACACCAGCGCTCGCATGTCAGCGGCTGAGATGCTCAAGTCTACGGACCCTCGC

TTCCAGAGATCTAGGTCGGAGCCTTCGGCAGACAGCCCGGACAGCCCATCCAGCTGCTCCCCCAACAAGAACAGGAGAGCTCAGGAAGAGTGGGCCAAGA

ACGAAGGCCTGATGCCTCGGAGTCTGTCCTTTTCGGGCCCTCGGTACAGCCGCAGCAGGACGCCACCCTCTGCGGCCAGCAGCAGGTACAGCATGCGGAA

CCGCATCCAGAGCAGCCCCATGACCGTCATCTCCGAGGGAGAGGGAGAACCTGCTGAGCCAGCGGACAACAAAGCACGCAGGGCCCTGGATGCTACCAGG

GTGTGCTCTCTGGACAGACTGACGGGTCAGGAGATGGACCAGGCCAGCCTCCTCTGTAGCGAGGAGCCTGCCTCTGTGGATGGGATAGGAAGGGCTGAGG

GCAACGGTCCCTCGGAGCAGTGTGGGGGTACGGAACAGAAGAGTTAGTATCAGAGCCTGCCTCTCATGAGTGAGGCAGGAAGGTGAGCTGTGCATCACTC

TAGGAAGTCTCTGTGGCCTTTTCCTGGCTTGTGGGGACCCCACTCAGCATTGGTGTTGGGGAGGTCTCGGCCTTTCGGGTCTCTTAGGACTCACTCGCCG

TGTGGCTTAAAAGCAAGTAGAAGCTTCAACTTCTGAAAGTGCTTCCTGGGGAAGATGGTTTGCTTTTGTTGTTTTGTTTTGTTTTTCCCAAAATGCTGGG

TGTGTGTATATGTGTGAATTTTGAGTACTTCATTCTAACAAATACACACACTAACGTTACGTATAGAAATAGGAGAAAAGGTCAGAGTTCAGGTAGGGTA

ATGGAGTCCACTAGACCAGGGTGATAAGTGGTTTCAGCGCATTACGGGTGTGGGAATGTGTAAGTTCACGAAGAGACTGGAAGCCGTTAGTGGGCTGGTT

CTAAGTATAGAACATGTCTGTGTGTGCACTTACTCAAGACACACGGGAAACCAGGAAGGGGCTGGGAAGTGGCTAAGCAACTCATTGGTTCAGGTACTTT

AGGGGGCGGGGAGGCCTTGGTGCAGCTGCCGCCTCCTCCTCCTCCCCCTCCTCCTCCGCTTGTAAAAATTACACAAATGGAAGTGGCAAGGCTGTGTCCT

GTGCCTACTGCATACATTTCTAGCCTTGGTGTCAGAAGCATGGGTGGGTTTTTAGTTTGTTGGCTTTTTTTTTTTTTTTAAATGAATTCCTTCCTGGAGT

TGTTAATGAAGAATGAAGGAAGAGAGGCATCGTGAGAGAAGGGTAGGGGAGTGATTAATACTGCTGGATTTGTTTCCTGCTTATTAAATAAAATATTTTC

ACAATTAAATCAGAAAACATGCACTGTAGAATTATAGGTGAAGCTTTTCTTTTAAAGAGTCGTTTTGTTTTACAATCAGAGTTTTAACTTCCATGTGACA

GTTTGTCACTTGAAATGTGACACCTGGCATTTTCTAACTTTTGGCTATACCAAAGAAAAATAATATGGCTATTTTTCACCCCTGAACTGCTTACAGCATC

TTGTTTTAATTTAGAAGGGTTTACCAAAATCTATTATATATTATCTCCCTTTGAAGAAAACGGTGACTCTAGTCAGTGACAGAAATTGCTGAAAATCGGT

AGGGCATGGCTATGAACTAGCCCTGGGAAATGAGTTTTTAGATTAAAAAGATTTTTTTTTCTTTTGCACAGCCTGGTTTGTATGATTTTATATTTGTTTA

TGAGTTGAGTTGCTGAGTCCCTTCGAGGCTCCTCCCATCAGAATTGCAAATGTGCTTTAGAACCGGGATTAGAGTGTACAACCGTATTTATTTTAATATC

ACCTCCTTGGGCTCCTTGCCCACTCCCAGGTTCCGTGTATCCAGCCGAAGCGCACGCTACCTTAGTCTCCCAGTGGCTACACTGACCTTCTAAAGCTGCT

GGCAGTGGCCATTGACAATGTGTGACAGTGTCTGGAAGTCAAGCCACACAAGCCAAAGCATCCAAGACTTCTTCCACAGAACCTTTGATAGCCATTTCAG

ATACATCTCTGAGGAGAGAATCTAGCAAACAAAGCACGCCTCACAGCCGCAAATGATGACCTGACATGTGGCCTCAGAGATTTGTTTTTTTTTTTTTCCT

AAATCCGCTGTGTCACTTTTCAACTGTGTGGGCACACAGATCATCTCCTGTAAATCTTAGGCCATGTTGACATTTGAATACCTAAAAAAGATTAGAATGT

ATGTGGATATCAGAAATCTTAAACTTAATATATCAATATTTGTTTGAAGGTAAGATAAGCAGCATTAGAACTAATTATAAAATGATTTTAAATCCCTCAT

TTAAAAGGTATTTATTAGGTTTTAAGTTTGTTTTCAATAAAACAATTGTAAAGCCAATATTTG
Translation
MKKDGSSGSFGIKASPGSLSRAVSWINFSSLSRQTKRLFRSDGELSVCGHQVEADDENWIYRTQPRKA - UNI15877 - - UNI30916 - AVSNL

DEESRWTVHYTAPWHQQENVFLPATRPPCVEDLHRQAKLNLKSVLRE ECDKLRQDGCRSSQYYSQGPTFAAGSSPCDDYQDEDTEADRK CSLSSSEEE

RFIGIRRPKTPTSGDFSDLHTQTNWTKSLPLPTPEEKTRQQAQTVQADVVPINITA - UNI31185 - ASATGQDDDGSAHSLYVPDHYSTLGRLDSY

RSTGQCLETRDTSCQTEDVKVIPPSMRRIRAHKGVGVAAQMSHLSGSSGNMSVLSDSAGVVFPSRLSNDTGFHSLPRTGPRASTYSLEGRMGALGSTEDT

DDTSPYQGGSLQGHENFAHLGGASSTGMLSRPKSQQLRFLESPACVVSPHAAYSTSVIPNATLLSSSEVIVIHTAQSAGQLDSRTPGSSSYSKIKPRDRP

TPRCSVKDDHQSPRHHWNEGHLIHSRALASSVPGATTLLSLHDSEVSLNAPANRENGSQAILYHCRNNPSFPDHPSDVDGKSECSYSGDRGCGSSEPWEY

KTSSNGRASPLKPHLATPGCSTPTSNVSSCSLDQTSLKGDTRSLCSEDHDGYYTTTHEAGNLYTLSDGLGNPRHSMVNVFDGRAQRSQGDQAAHQDKILS

RNISLKKAKKPPLPPSRTDSLRRIPKKNNQTNGQVLNESLIASLQHSLQLSLPGKGGSSPSQSPCSDFEEPWLPRSRSQSIVSEGSSLTSTTTPNVYSLC

GVTPSQSDTSSVKSEYTDPWGYYIDYTSLQEDPGNPTGGCSANTEAATGNGPVRHIQEGSRVPVPQVPGCSVRPKIASPEKSQRVTSPSSGYSSQSNTPT

ALTPVPVFLKSMSPANGKGKAKPKVPERKSSLISSMSISSSSTSLSSNTSTEGSGTMKKLDTTLASALAPPPPPLPPLPSPCLADKSPFLPPPPPLADCS

EGSPLPPSPMFPPPPPEALVPFCSPTDGCLSPSPTAVSPSLPRSLPPVPAPPPFLPSSEPPPAPPLDPKLMKENRPFFKNSSQSESSREALRRPANKEEG

CRPPMPLITTEALQMVQLRPVRKNSGAGAVLFSEPSAQEQRTPTAPQYHLKPSAFLKSRNSINEMESESQAASVTSSLPMPAKSQSQGDHDSAVERGGLP

SCSDGAPGPGPSLRTTLLPDSSPSRKPPPISKKPKLFLVVPPPQRDFTAEPTENGSEAFPGVPSPTRAEGEAVRSQEEKSSPASRAGSHATAPTPGSPAL

EPGTAGSLSSSIVEANVPMVQPNTSPGPTQEESGENSVDGERNAKSCLSQQGREA AGLLEPNTAASSSDPVDVSKEEGSDEVLTPTKPRTTEDLFAAIH

R RSKRKVLGRKDSEDDHTRNHSPSPPVTPTSAAPNLASPKQVGSIQRSIKKSTTSSDNFKALLLKKGSRSDTSARMSAAEMLKSTDPRFQRSRSEPSAD

SPDSPSSCSPNKNRRAQEEWAKNEGLMPRSLSFSGPRYSRSRTPPSAASSRYSMRNRIQSSPMTVISEGEGEPAEPADNKARRALDATRVCSLDRLTGQE

MDQASLLCSEEPASVDGIGRAEGNGPSEQCGGTEQKS

For any suggestions or comments, please send an email to unitrap@crg.es