Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000039844 (Rapgef1)
Chromosomal location
Chr 2: 29475240 - 29595883 (+)
Description
Rap guanine nucleotide exchange factor (GEF) 1 Gene [Source:MGI (curated);Acc:Rapgef1-001]
RefSeq_dna
NM_054050 NM_001039086 NM_001039087 
RefSeq_peptide
NP_473391.1 NP_001034175.1 NP_001034176.1 
UniGene
Mm.298274 
MGI
MGI:104580 
Uniprot/SPTREMBL
Q8C5V7 Q91ZZ2 A2ARB7 Q3UGX8 A1L338 A2ARB4 A2ARB5 Q3UHC1 
Human Ortholog
ENSG00000107263 (RAPGEF1)
Omim not available
UniTrap UNI5122
Vector Insertion
Chr 2: 29475239 - 29475584
Public Clones YTC280 (baygenomics) Q008B02 (ggtc) A058A07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13709
Vector Insertion
Chr 2: 29475584 - 29534652
Public Clones CMHD-GT_268E12-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15349
Vector Insertion
Chr 2: 29475584 - 29534652
Public Clones (sanger) E079E09 (ggtc) D147G08 (ggtc) D050D02 (ggtc) E132H08 (ggtc)
E049G12 (ggtc) D093F03 (ggtc) E088C02 (ggtc) D174C09 (ggtc) D051H01 (ggtc)
E067D11 (ggtc) D112H11 (ggtc) E088D02 (ggtc) D093B12 (ggtc) E085A09 (ggtc)
CMHD-GT_490B11-3 (cmhd) PST1225 (escells) IST10221A4 (tigm) IST10468G4 (tigm)
IST13665C11 (tigm) IST14886A3 (tigm) IST11417G11 (tigm) IST10885A5 (tigm)
IST12955A4 (tigm) IST14057D3 (tigm) IST10056B8 (tigm) IST10821A5 (tigm)
IST12127C7 (tigm) IST10311A10 (tigm) IST12414H1 (tigm) IST10975G9 (tigm)
IST13362D8 (tigm) IST12332D1 (tigm) IST15002A9 (tigm) IST11669H2 (tigm)
IST10147D2 (tigm) IST14138H4 (tigm) IST14482G1 (tigm) IST14944C12 (tigm)
IST13685E3 (tigm) IST10675C2 (tigm) IST10057F7BBR1 (tigm) IST11846F8 (tigm)
IST10380G7 (tigm) IST14599A6 (tigm) IST10786F10 (tigm) IST13025E4 (tigm)
IST10459G3 (tigm) IST14683C9 (tigm)
Private Clones OST452917 (lexicon) OST433014 (lexicon) OST421256 (lexicon) OST420808 (lexicon)
OST414361 (lexicon) OST365091 (lexicon) OST347593 (lexicon) OST341179 (lexicon)
OST332374 (lexicon) OST325984 (lexicon) OST313176 (lexicon) OST299088 (lexicon)
OST290292 (lexicon) OST272050 (lexicon) OST250207 (lexicon) OST225763 (lexicon)
OST224922 (lexicon) OST215931 (lexicon) OST209861 (lexicon) OST207842 (lexicon)
OST201654 (lexicon) OST200678 (lexicon) OST186695 (lexicon) OST186111 (lexicon)
OST182436 (lexicon) OST179851 (lexicon) OST149901 (lexicon) OST125099 (lexicon)
OST124297 (lexicon) OST113626 (lexicon) OST103484 (lexicon) OST100635 (lexicon)
OST93146 (lexicon) OST78666 (lexicon) OST57494 (lexicon) OST56783 (lexicon)
OST46477 (lexicon) OST43137 (lexicon) OST30629 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26155
Vector Insertion
Chr 2: 29535256 - 29535371
Public Clones not available
Private Clones OST133927 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3468
Vector Insertion
Chr 2: 29535371 - 29541624
Public Clones AG0186 (sanger) IST12990G10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24459
Vector Insertion
Chr 2: 29541624 - 29541804
Public Clones not available
Private Clones OST219395 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36004
Vector Insertion
Chr 2: 29541804 - 29544626
Public Clones IST12924B6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8258
Vector Insertion
Chr 2: 29544784 - 29554516
Public Clones RRF089 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30961
Vector Insertion
Chr 2: 29544784 - 29554516
Public Clones (sanger) CMHD-GT_534F8-5S (cmhd) IST10756A5 (tigm) IST14051B9 (tigm)
IST10304B12 (tigm) IST14660G7 (tigm) IST12532D7 (tigm) IST10903A7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20901
Vector Insertion
Chr 2: 29554516 - 29554606
Public Clones not available
Private Clones OST348737 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17804
Vector Insertion
Chr 2: 29555205 - 29555359
Public Clones not available
Private Clones OST436180 (lexicon) OST378170 (lexicon) OST208422 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17809
Vector Insertion
Chr 2: 29576259 - 29577743
Public Clones not available
Private Clones OST436150 (lexicon) OST156672 (lexicon)
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25162
Vector Insertion
Chr 2: 29580405 - 29581725
Public Clones not available
Private Clones OST193466 (lexicon)
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36332
Vector Insertion
Chr 2: 29581802 - 29586047
Public Clones IST12708H4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 55% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24327
Vector Insertion
Chr 2: 29588346 - 29588440
Public Clones not available
Private Clones OST224723 (lexicon)
Severity of mutation (?) Insertion after 59% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000048301
Sequence
GGGCTTCCGGCAGGTGGCGCCGTGGCCGCGGGGCCCAGGCCGGCGGGCGGGCGGCGGCGCGGCGCTGCGGCCGGCGGCTCGCGGCCCCGGAGCGGCGGCT

GCGCGGGAGGTGGAGCGGCGGAGTGGCAGGCCCGGTGCGGGCTGGAGCGCGGGCGGCGAGCGCACGAGCCGCGGCCGCGCGGAGCCCGCCATGACGGCGC

GAGTGTGAGGCGCGGCGAGCACCGGTCCAGTAGAGCGGCGGGCGCGCCGGCCTCTTATCCCGCAGCGGCCGGGCCGGGCCCTGATGAGCAGCGGCCTCGG

CCTCCGGCGCAGCCCGGAAATGTCCGGCAAGATCGAGAAAGCAG - UNI5122 - - UNI13709 - - UNI15349 - ACTCTCAGCGTTCTCAT

CTCTCCTCCTTCACCATGAAGCTGATGGACAAATTCCACTCTCCCAAAATCAAGAGAACACCATCCAAGAAGGGAAAGCCAGCCGAGGTGTCGAAGATTC

CTGAGAAGCCTGTGAGCAAA - UNI26155 - GAGGCAAGAGACAGATTTCTACCAGAGGGCTACCCTATCCCCTTGGATCTGGAGCAGCAGGCAGTA

GAATTTATGTCCACCAGTGCTGTGGCTTCCAGGTCTCAGAGGCAGAAG - UNI3468 - - UNI24459 - - UNI26155 - AACCTGTGCTGGC

TGGAGGAGAAAGAGAAGGAGGTTGTCAGTGCCTTGCGCTACTTTAAGACCATTGTGGACAAAATGGCCATTGATAAGAAGGTTCTGGAGATGCTCCCGGG

GTCAGCCAGCAAGGTGCTGGAGGCCATCTTACCCCTGGTGCAGACTGACCCTCGGATCCAGCACAG - UNI24459 - - UNI36004 - CTCAGCC

CTCTCCTCCTGTTATAGCCGAGTATACCAGAGCCTCGCCAACCTTATCCGATGGTCTGACCAGGTGATGCTAGAGGGCGTGAACTCAGAAGATAAGGAGA

TGGTGACAACTGTGAAGGGCGTTATCAAAGCTGTCCTGGACGGAGTGAAG - UNI8258 - - UNI20901 - - UNI30961 - GAGCTAGTGAG

GCTAACCATTGAGAAGCAGGGGCGGCCATCGCCAACAAGCCCAGTGAAGCCCAGTTCCCCAGCCAGCAAGCCTGATGG - UNI17804 - - UNI209

01 - CCAGCCTGAGCTCCCTCTGACAGACCGAGAAATGGAGATTCTGAACAAGACGACAAGTGTGTCACCATCTGCTGAACTGCTCCCAGACTCCACCA

GTGAAGAGGTCGCACCCCCCAAGCCCCCTTTACCTGGCATCCGGGTGGTTGATAACAG - UNI17804 - TCCACCAGCATTACCACCCAAGAAAAGG

CAGTCTGCTCCATCCCCCACTCGGGTGGCTGTGGTAGCCCCAATGAGTCGGGCTACCAGTGGCTCCAGTTTGCCTGTTGGAATCAATAGGCAG GACTTT

GATGTTGAATGTTACACCCAGAGGCGCCTGTCAGGAGGCAGCCGCTCCTGCGGTGGTGAGTCTCCTCGCCTGTCCCCCTGCAGCAGCACAGGCAAGCTCA

GCCGCTCAGACGAGCAGCTGTCCTCCCTGGACAGGGATAGTGGGCAGTGCTCACGGAACACAAGCTGTGAAACACTAG ATCACTACGACCCCGACTATG

AATTCCTCCAGCAAGATCTCTCCAATGCAGACCAGATCCCTCCACAGGCAGCCTGTAACCTCAGCCCTCTGCCGGAGTCCCTGGGGGAATCTGGGCCTCC

ATTTCTTGGCCACCCTTTCCAGCTGCCTTTGGGCAGCTGTCTGCAGCAGGAGGGACAGCAGACAGACACTCCACCTGCCCTTCCGGAGAAGAAGCGTAGG

AGCGCAGTCTCCCAGACCACGGACAGCTCTGGCTGCAGGGTGTCCTATGAGCGACACCCCTCACAGTATGACAACATCTCAGAGGGTGACCTGCAGAACC

CAGTCCCAGTCCAGCCTGTGCCCTACCCACCCTTTGCTGCTGTCCTGCCCTTTCAGCAGGGAGCTTCCTCTGCCTCTGCTGAGTTTGTGGGTGATTTCAG

TGTTCCTGAGTTGGCGGGTGACACAGAGAAGCCACCTCCTCTACCAGAGAAGAAGAACAAGCACA TGCTGGCCTACATGCAACTGCTGGAGGACTACTC

AGAGCCACAGCCCTCCATGTTCTACCAGACACCGCAGAGTGAGCACATCTACCAGCAGAAGAACAAGATGCTCATGGAGGTGTACGGCTTCAGCGAGTCC

TTCTGCGGTAGTGATTCCACGCAGGAGCTGGCCCCTCCACCCGCTCTGCCCCCCAAGCAACGGCAGCTG GCCTCCTATGCTGCTTCTTCCTTCTCTGTC

TCCTACTGTGTCCAGCAAACTAAAGTGGCCTTCACCCCCGAGGACGGCAGTGCCGCTCAGGGCCTCAGTGTATCCGTGTCTAACTCCTTTCTCAACCGGC

ACGGCAGCTTGCCTGTGCCCTCG - UNI17809 - GAACCACCATCTGGGAAGGACGGACATCCCAGAGATCCTTCGGTCAGCAGTGCATCTGGGAAG

GACAGCAGAGAAAATGGGGAAAG GTCCCCAAAGTCACTGGATGGTCTGGAGTCAGCGCAGTCAGAAGAGGAAGTGGATGAACTGTCCCTCATTGACCAC

AATGAAATTATGGCCAGGCTGACACTCAAGCAAGAG - UNI25162 - GGTGATGATGGGCCAGATGTTCGTGGTGGTTCAGGAGACATCTTACTGGT

CCATGCTACTGAGACAGACAGAAAAG - UNI36332 - ACCTGGTGCTGTACTGTGAAGCCTTCCTGACCACCTACAGGACCTTCATCAGCCCGGAGG

AGCTCATCAAGAAGCTGCAGTACCGATAT - UNI24327 - GAGAAGTTCTCTCCCTTTGCTGACACGTTCAAGAAGCGAGTGAGCAAGAACACATTC

TTTGTGCTGGTTCGAGTGGTGGATGAGCTCTG - UNI24327 - CCTGGTGGAGCTGACAGAGGAGATCCTGAAGCTGCTGATGGAGCTGGTCTTCCG

CCTAGTGTGCAGCGGAGAGCTCAGCCTGGCCAGAGTCCTCCGGAAGAACATTCTGGACAAGGTGGACCAGAAGAAGCTGCTCAGGTGTGCCCATTCCGAC

CAGCCTCTGGCAGCCAGGGGTGTTGCAGCCAG GCCAGGAACCTTGCATGATTTCCACAGCCACGAGATAGCTGAGCAGCTGACACTGCTGGATGCCGAG

CTTTTCTACAAGATAGAG ATTCCTGAAGTTTTGCTTTGGGCCAAAGAGCAGAATGAGGAGAAGAGTCCCAATCTGACCCAGTTCACAGAGCACTTCAAC

AACATGTCCTACTG GGTGCGGTCCATCATCATGCTGCAGGAGAAGGCCCAGGACCGGGAGAGGCTGCTCCTCAAGTTCATCAAGATCATGAAG CACCT

GCGCAAGCTCAACAACTTCAACTCCTACCTGGCCATCCTCTCAGCACTAGACTCGGCCCCCATCCGCAGACTGGAGTGGCAGCGGCAGACCTCAGAG GG

CCTGGCTGAGTACTGCACATTGATTGACAGCTCATCCTCCTTCCGAGCCTACCGGGCTGCTCTCTCAGAGGTGGAGCCCCCATGTATCCCATACCT AGG

TCTGATTCTGCAAGACCTGACCTTCGTTCACCTGGGAAACCCAGATTATATTGACGGGAAAGTAAACTTCTCCAAGCGGTGGCAACAGTTCAACATATTG

GACAGCATGCGGTGCTTCCAGCAGGC GCACTATGAAATCCGGAGAAACGACGACATCATAAATTTCTTCAATGACTTCAGTGACCACCTGGCCGAGGAA

GCCCTGTGGGAACTCTCTCTGAAGATCAAGCCTAGGAACATAACAAGGCGGAAAACAGACCGCGAAGAGAAGACCTAGGAGCAGGCTGGCTGTGAGAACG

CTCAAGCAGCCAGGAGAGGACCTGGACCATCCCAGCCTCAGCCTGTCCATGCCTGGCTGTGTGGCAGCACCTGAGTCTCCTGGCCGGTCTCCTGCCTCCT

TCCCTATGGCTAAAGTCCCAGGGTTCACAATGAGCTGGCTGGCAGGCCTCAGGGCTGGCTTGTGTACTGGTGGCCCCTGGTCTGGTTTTGTTTTCTGTTT

TCTGTCAGTGCTCCCTCCTGTTCCCTCCTCTCCCCTGCAGCTGGAGAGCAGCAGACACCTGAGCAGCAGACCAGGGGAATGGCGGGCTTCACTGTCCCCA

GGCCACCCTAGCCTCCTTAAGTGGCAGATAAGTAGGGGCCCCAGGACCCTTGGGTAGACTGCCCTCCGGGACCCTGGAGCCAGGGGAGCTATGGCTGGGA

GACAGAAGAAGGTAGAAAGGGACCACGCAGGCATCTTGTGCTGCCCACTTCCTGCTTTTTAAACATGGAGGGAGAGGCATGTCAACCTGGCCCAGAAAGT

ATGGTGGGTGGTAGGCAAGAGCCACAGAGCTGACACTTCTCACAGCAGTGGCCCCAGCTCTGTCCTGCCATGCACGGCCACTAACCAAGGCACCTGCTGG

GCTGACAGCAGCAGCACCAGTAGCACCTGTCGCCCACCACTGGTCCAGCCCCAGCCCCAGCCCCAGCCCCAGCCCACATCACCGGTACTCTGGGGATCGG

GAAGAGGAGGCAGAAGGGACAGTTCATGCTGAGCTGGGGCCAAGACTGTGCTTCAGAGAGTGAATAAGGATCTTCAGTGACCTAGGGAGAGGCAAGCAGC

CCCTCCGTGCTTGCTGTGTGCCTTAAATGCCATCTCCTGTTCCTTCCAGGCCTGTGGGCTTCCCTCCTATTTTGCCCCACCCCCCGCAGCCAGCAGGTTC

CTAGTCCCCGTTTGCTCTCTGGGAGTGTCTGTTCCCAAGAAGTCTAAGCAGGCCTAGGACGTGAGGGCCTCCAGAGGTTTCCTGATTCCAGACAGGTGGC

AGAGCCACCCCCTGCTGCTGAGGTTGACAATCTGTTCAGGGCTCAGGGCTAGGATCTCCCTGGGCATGGCCCTGTGGCCACCACTGTGGGCTAAATGGCA

GGGTGCAGTTCAGAATCCAGAGGTGCTGCTGGCCCTGCACCATACCTCCAATTAGCTTTGCATGGACAAGCTCCCTTTTCTTCTGGTCGTGGGGCTTGGT

CAAACGAATACCAGGATCTCTGCTTCCTCAACCAGTCCGCAGAGCAGAAGAAAAGACAGCAGCAGCTGCTGGCCGGGTACTCGTTTGAAACAACTGTCAC

TCTGAACCCTCCTGGGTTTCGGGGTTTGTTTTTTTAGCAGCTTTTATCAAATAAGAACTGTGGGCCCCTCTTCTGTTTATTTGTGCTGTAAATAGAGAGG

GGACATCTGTAAACAGCCCCTTGGTCAGCTCCCTCTGGTGGCAGCCGGAATTGGATTGTTTAAGGAGTGTGTGTGTGGAGTCCGGCTTGTGAGCAGTCAT

GTGGGTCTTTGGTTTGTTCCTCTTTTACAGGTCCTTTCATTTCAGTCTTTGCCCCTGCTTCCTGTCCTTCACCAGCTCTAAGTGCTGCTGTGTGCAAGTG

GGGAACACTGCACATGAGGTCCTTCCTCCCAGCGCTGTAGAGGCCCCTGCAGCCTCCCTGTGTAGCACAGGCCTACCTGAGGCCTAGCCTACTGGTGCTG

CAGCCAACAGAGTGGGTCTATGGTCTATGTCTACTGGTTCCCAAGCATGAGCTGGGCAGAAAGGAGGGCTTACCTTCTAGACCCAGAATCACCAGGCCCT

CCTATGATCCTGGGAGCCTTAGGCAGACTAAGTCAAGAGCCAGGACAGCTCTGGAGTTTCCGTGTGGGGATATCGAGGTGCGATGTGTGGGTTTAACTTA

TTAGCCAGCAGGCTTCCCCAGTCACCTGCCTCTGGCTGCGACTGAGCCCAGTGTTCAGGCAGCCTGGCTTCCACATGTCTGTTTCTTAGTGGTGGGGTCT

GGGAGAGCTGTGAAGATTCGTCTTTGTATACATACTAAGCAACATGGACAGTTGGGTTCCCAGCAGAGGCCAGCCATTACCTGTGGGTAAGGCAAGCAAA

CACCGGATCTGGCTGGCCCTTAAGCCGAGACACCTGTTCCATGCCTCCCAGTGTGGCACTGTAATATAAACCCCCCACTAACCTGTCTGACAGTGCATCT

TCCTACAGACAGAACAAGCGCGCAACTTTTATATGAAAGAAAAATAAACAGACAAAAGCCCATCTGATGCC
Translation
 - UNI5122 - - UNI13709 - - UNI15349 -  - UNI26155 -  - UNI3468 - - UNI24459 - - UNI26155 -  - UNI24

459 - - UNI36004 -  - UNI8258 - - UNI20901 - - UNI30961 -  - UNI17804 - - UNI20901 -  - UNI17804 - M

SRATSGSSLPVGINRQ DFDVECYTQRRLSGGSRSCGGESPRLSPCSSTGKLSRSDEQLSSLDRDSGQCSRNTSCETLD DHYDPDYEFLQQDLSNADQI

PPQAACNLSPLPESLGESGPPFLGHPFQLPLGSCLQQEGQQTDTPPALPEKKRRSAVSQTTDSSGCRVSYERHPSQYDNISEGDLQNPVPVQPVPYPPFA

AVLPFQQGASSASAEFVGDFSVPELAGDTEKPPPLPEKKNKHM MLAYMQLLEDYSEPQPSMFYQTPQSEHIYQQKNKMLMEVYGFSESFCGSDSTQELA

PPPALPPKQRQL ASYAASSFSVSYCVQQTKVAFTPEDGSAAQGLSVSVSNSFLNRHGSLPVPS - UNI17809 - EPPSGKDGHPRDPSVSSASGKD

SRENGER RSPKSLDGLESAQSEEEVDELSLIDHNEIMARLTLKQE - UNI25162 - GDDGPDVRGGSGDILLVHATETDRKD - UNI36332 - 

DLVLYCEAFLTTYRTFISPEELIKKLQYRY - UNI24327 - EKFSPFADTFKKRVSKNTFFVLVRVVDELC - UNI24327 - CLVELTEEILKL

LMELVFRLVCSGELSLARVLRKNILDKVDQKKLLRCAHSDQPLAARGVAAR RPGTLHDFHSHEIAEQLTLLDAELFYKIE IPEVLLWAKEQNEEKSPN

LTQFTEHFNNMSYW WVRSIIMLQEKAQDRERLLLKFIKIMK HLRKLNNFNSYLAILSALDSAPIRRLEWQRQTSE GLAEYCTLIDSSSSFRAYRAAL

SEVEPPCIPYL LGLILQDLTFVHLGNPDYIDGKVNFSKRWQQFNILDSMRCFQQA AHYEIRRNDDIINFFNDFSDHLAEEALWELSLKIKPRNITRRK

TDREEKT
Transcript ENSMUST00000102872
Sequence
GGGCTTCCGGCAGGTGGCGCCGTGGCCGCGGGGCCCAGGCCGGCGGGCGGGCGGCGGCGCGGCGCTGCGGCCGGCGGCTCGCGGCCCCGGAGCGGCGGCT

GCGCGGGAGGTGGAGCGGCGGAGTGGCAGGCCCGGTGCGGGCTGGAGCGCGGGCGGCGAGCGCACGAGCCGCGGCCGCGCGGAGCCCGCCATGACGGCGC

GAGTGTGAGGCGCGGCGAGCACCGGTCCAGTAGAGCGGCGGGCGCGCCGGCCTCTTATCCCGCAGCGGCCGGGCCGGGCCCTGATGAGCAGCGGCCTCGG

CCTCCGGCGCAGCCCGGAAATGTCCGGCAAGATCGAGAAAGCAG - UNI5122 - - UNI13709 - - UNI15349 - ACTCTCAGCGTTCTCAT

CTCTCCTCCTTCACCATGAAGCTGATGGACAAATTCCACTCTCCCAAAATCAAGAGAACACCATCCAAGAAGGGAAAGCCAGCCGAGGTGTCGAAGATTC

CTGAGAAGCCTGTGAGCAAA - UNI26155 - GAGGCAAGAGACAGATTTCTACCAGAGGGCTACCCTATCCCCTTGGATCTGGAGCAGCAGGCAGTA

GAATTTATGTCCACCAGTGCTGTGGCTTCCAGGTCTCAGAGGCAGAAG - UNI3468 - - UNI24459 - - UNI26155 - AACCTGTGCTGGC

TGGAGGAGAAAGAGAAGGAGGTTGTCAGTGCCTTGCGCTACTTTAAGACCATTGTGGACAAAATGGCCATTGATAAGAAGGTTCTGGAGATGCTCCCGGG

GTCAGCCAGCAAGGTGCTGGAGGCCATCTTACCCCTGGTGCAGACTGACCCTCGGATCCAGCACAG - UNI24459 - - UNI36004 - CTCAGCC

CTCTCCTCCTGTTATAGCCGAGTATACCAGAGCCTCGCCAACCTTATCCGATGGTCTGACCAGGTGATGCTAGAGGGCGTGAACTCAGAAGATAAGGAGA

TGGTGACAACTGTGAAGGGCGTTATCAAAGCTGTCCTGGACGGAGTGAAG - UNI8258 - - UNI20901 - - UNI30961 - GAGCTAGTGAG

GCTAACCATTGAGAAGCAGGGGCGGCCATCGCCAACAAGCCCAGTGAAGCCCAGTTCCCCAGCCAGCAAGCCTGATGG - UNI17804 - - UNI209

01 - CCAGCCTGAGCTCCCTCTGACAGACCGAGAAATGGAGATTCTGAACAAGACGACAAGTGTGTCACCATCTGCTGAACTGCTCCCAGACTCCACCA

GTGAAGAGGTCGCACCCCCCAAGCCCCCTTTACCTGGCATCCGGGTGGTTGATAACAG - UNI17804 - TCCACCAGCATTACCACCCAAGAAAAGG

CAGTCTGCTCCATCCCCCACTCGGGTGGCTGTGGTAGCCCCAATGAGTCGGGCTACCAGTGGCTCCAGTTTGCCTGTTGGAATCAATAGGCAG GACTTT

GATGTTGAATGTTACACCCAGAGGCGCCTGTCAGGAGGCAGCCGCTCCTGCGGTGGTGAGTCTCCTCGCCTGTCCCCCTGCAGCAGCACAGGCAAGCTCA

GCCGCTCAGACGAGCAGCTGTCCTCCCTGGACAGGGATAGTGGGCAGTGCTCACGGAACACAAGCTGTGAAACACTAG ATCACTACGACCCCGACTATG

AATTCCTCCAGCAAGATCTCTCCAATGCAGACCAGATCCCTCCACAGGCAGCCTGTAACCTCAGCCCTCTGCCGGAGTCCCTGGGGGAATCTGGGCCTCC

ATTTCTTGGCCACCCTTTCCAGCTGCCTTTGGGCAGCTGTCTGCAGCAGGAGGGACAGCAGACAGACACTCCACCTGCCCTTCCGGAGAAGAAGCGTAGG

AGCGCAGTCTCCCAGACCACGGACAGCTCTGGCTGCAGGGTGTCCTATGAGCGACACCCCTCACAGTATGACAACATCTCAGAGGGTGACCTGCAGAACC

CAGTCCCAGTCCAGCCTGTGCCCTACCCACCCTTTGCTGCTGTCCTGCCCTTTCAGCAGGGAGCTTCCTCTGCCTCTGCTGAGTTTGTGGGTGATTTCAG

TGTTCCTGAGTTGGCGGGTGACACAGAGAAGCCACCTCCTCTACCAGAGAAGAAGAACAAGCACA TGCTGGCCTACATGCAACTGCTGGAGGACTACTC

AGAGCCACAGCCCTCCATGTTCTACCAGACACCGCAGAGTGAGCACATCTACCAGCAGAAGAACAAGATGCTCATGGAGGTGTACGGCTTCAGCGAGTCC

TTCTGCGGTAGTGATTCCACGCAGGAGCTGGCCCCTCCACCCGCTCTGCCCCCCAAGCAACGGCAGCTG - UNI17809 - GAACCACCATCTGGGAA

GGACGGACATCCCAGAGATCCTTCGGTCAGCAGTGCATCTGGGAAGGACAGCAGAGAAAATGGGGAAAG GTCCCCAAAGTCACTGGATGGTCTGGAGTC

AGCGCAGTCAGAAGAGGAAGTGGATGAACTGTCCCTCATTGACCACAATGAAATTATGGCCAGGCTGACACTCAAGCAAGAG - UNI25162 - GGTG

ATGATGGGCCAGATGTTCGTGGTGGTTCAGGAGACATCTTACTGGTCCATGCTACTGAGACAGACAGAAAAG - UNI36332 - ACCTGGTGCTGTAC

TGTGAAGCCTTCCTGACCACCTACAGGACCTTCATCAGCCCGGAGGAGCTCATCAAGAAGCTGCAGTACCG - UNI24327 - GTACGAGAAGTTCTC

TCCCTTTGCTGACACGTTCAAGAAGCGAGTGAGCAAGAACACATTCTTTGTGCTGGTTCGAGTGGTGGATGAGCTCTG - UNI24327 - CCTGGTGG

AGCTGACAGAGGAGATCCTGAAGCTGCTGATGGAGCTGGTCTTCCGCCTAGTGTGCAGCGGAGAGCTCAGCCTGGCCAGAGTCCTCCGGAAGAACATTCT

GGACAAGGTGGACCAGAAGAAGCTGCTCAGGTGTGCCCATTCCGACCAGCCTCTGGCAGCCAGGGGTGTTGCAGCCAG GCCAGGAACCTTGCATGATTT

CCACAGCCACGAGATAGCTGAGCAGCTGACACTGCTGGATGCCGAGCTTTTCTACAAGATAGAG ATTCCTGAAGTTTTGCTTTGGGCCAAAGAGCAGAA

TGAGGAGAAGAGTCCCAATCTGACCCAGTTCACAGAGCACTTCAACAACATGTCCTACTG GGTGCGGTCCATCATCATGCTGCAGGAGAAGGCCCAGGA

CCGGGAGAGGCTGCTCCTCAAGTTCATCAAGATCATGAAG CACCTGCGCAAGCTCAACAACTTCAACTCCTACCTGGCCATCCTCTCAGCACTAGACTC

GGCCCCCATCCGCAGACTGGAGTGGCAGCGGCAGACCTCAGAG GGCCTGGCTGAGTACTGCACATTGATTGACAGCTCATCCTCCTTCCGAGCCTACCG

GGCTGCTCTCTCAGAGGTGGAGCCCCCATGTATCCCATACCT AGGTCTGATTCTGCAAGACCTGACCTTCGTTCACCTGGGAAACCCAGATTATATTGA

CGGGAAAGTAAACTTCTCCAAGCGGTGGCAACAGTTCAACATATTGGACAGCATGCGGTGCTTCCAGCAGGC GCACTATGAAATCCGGAGAAACGACGA

CATCATAAATTTCTTCAATGACTTCAGTGACCACCTGGCCGAGGAAGCCCTGTGGGAACTCTCTCTGAAGATCAAGCCTAGGAACATAACAAGGCGGAAA

ACAGACCGCGAAGAGAAGACCTAGGAGCAGGCTGGCTGTGAGAACGCTCAAGCAGCCAGGAGAGGACCTGGACCATCCCAGCCTCAGCCTGTCCATGCCT

GGCTGTGTGGCAGCACCTGAGTCTCCTGGCCGGTCTCCTGCCTCCTTCCCTATGGCTAAAGTCCCAGGGTTCACAATGAGCTGGCTGGCAGGCCTCAGGG

CTGGCTTGTGTACTGGTGGCCCCTGGTCTGGTTTTGTTTTCTGTTTTCTGTCAGTGCTCCCTCCTGTTCCCTCCTCTCCCCTGCAGCTGGAGAGCAGCAG

ACACCTGAGCAGCAGACCAGGGGAATGGCGGGCTTCACTGTCCCCAGGCCACCCTAGCCTCCTTAAGTGGCAGATAAGTAGGGGCCCCAGGACCCTTGGG

TAGACTGCCCTCCGGGACCCTGGAGCCAGGGGAGCTATGGCTGGGAGACAGAAGAAGGTAGAAAGGGACCACGCAGGCATCTTGTGCTGCCCACTTCCTG

CTTTTTAAACATGGAGGGAGAGGCATGTCAACCTGGCCCAGAAAGTATGGTGGGTGGTAGGCAAGAGCCACAGAGCTGACACTTCTCACAGCAGTGGCCC

CAGCTCTGTCCTGCCATGCACGGCCACTAACCAAGGCACCTGCTGGGCTGACAGCAGCAGCACCAGTAGCACCTGTCGCCCACCACTGGTCCAGCCCCAG

CCCCAGCCCCAGCCCCAGCCCACATCACCGGTACTCTGGGGATCGGGAAGAGGAGGCAGAAGGGACAGTTCATGCTGAGCTGGGGCCAAGACTGTGCTTC

AGAGAGTGAATAAGGATCTTCAGTGACCTAGGGAGAGGCAAGCAGCCCCTCCGTGCTTGCTGTGTGCCTTAAATGCCATCTCCTGTTCCTTCCAGGCCTG

TGGGCTTCCCTCCTATTTTGCCCCACCCCCCGCAGCCAGCAGGTTCCTAGTCCCCGTTTGCTCTCTGGGAGTGTCTGTTCCCAAGAAGTCTAAGCAGGCC

TAGGACGTGAGGGCCTCCAGAGGTTTCCTGATTCCAGACAGGTGGCAGAGCCACCCCCTGCTGCTGAGGTTGACAATCTGTTCAGGGCTCAGGGCTAGGA

TCTCCCTGGGCATGGCCCTGTGGCCACCACTGTGGGCTAAATGGCAGGGTGCAGTTCAGAATCCAGAGGTGCTGCTGGCCCTGCACCATACCTCCAATTA

GCTTTGCATGGACAAGCTCCCTTTTCTTCTGGTCGTGGGGCTTGGTCAAACGAATACCAGGATCTCTGCTTCCTCAACCAGTCCGCAGAGCAGAAGAAAA

GACAGCAGCAGCTGCTGGCCGGGTACTCGTTTGAAACAACTGTCACTCTGAACCCTCCTGGGTTTCGGGGTTTGTTTTTTTAGCAGCTTTTATCAAATAA

GAACTGTGGGCCCCTCTTCTGTTTATTTGTGCTGTAAATAGAGAGGGGACATCTGTAAACAGCCCCTTGGTCAGCTCCCTCTGGTGGCAGCCGGAATTGG

ATTGTTTAAGGAGTGTGTGTGTGGAGTCCGGCTTGTGAGCAGTCATGTGGGTCTTTGGTTTGTTCCTCTTTTACAGGTCCTTTCATTTCAGTCTTTGCCC

CTGCTTCCTGTCCTTCACCAGCTCTAAGTGCTGCTGTGTGCAAGTGGGGAACACTGCACATGAGGTCCTTCCTCCCAGCGCTGTAGAGGCCCCTGCAGCC

TCCCTGTGTAGCACAGGCCTACCTGAGGCCTAGCCTACTGGTGCTGCAGCCAACAGAGTGGGTCTATGGTCTATGTCTACTGGTTCCCAAGCATGAGCTG

GGCAGAAAGGAGGGCTTACCTTCTAGACCCAGAATCACCAGGCCCTCCTATGATCCTGGGAGCCTTAGGCAGACTAAGTCAAGAGCCAGGACAGCTCTGG

AGTTTCCGTGTGGGGATATCGAGGTGCGATGTGTGGGTTTAACTTATTAGCCAGCAGGCTTCCCCAGTCACCTGCCTCTGGCTGCGACTGAGCCCAGTGT

TCAGGCAGCCTGGCTTCCACATGTCTGTTTCTTAGTGGTGGGGTCTGGGAGAGCTGTGAAGATTCGTCTTTGTATACATACTAAGCAACATGGACAGTTG

GGTTCCCAGCAGAGGCCAGCCATTACCTGTGGGTAAGGCAAGCAAACACCGGATCTGGCTGGCCCTTAAGCCGAGACACCTGTTCCATGCCTCCCAGTGT

GGCACTGTAATATAAACCCCCCACTAACCTGTCTGACAGTGCATCTTCCTACAGACAGAACAAGCGCGCAACTTTTATATGAAAGAAAAATAAACAGACA

AAAGCCCATCTGATGCC
Translation
MSSGLGLRRSPEMSGKIEKAD - UNI5122 - - UNI13709 - - UNI15349 - DSQRSHLSSFTMKLMDKFHSPKIKRTPSKKGKPAEVSKIP

EKPVSK - UNI26155 - EARDRFLPEGYPIPLDLEQQAVEFMSTSAVASRSQRQK - UNI3468 - - UNI24459 - - UNI26155 - NLC

WLEEKEKEVVSALRYFKTIVDKMAIDKKVLEMLPGSASKVLEAILPLVQTDPRIQHS - UNI24459 - - UNI36004 - SSALSSCYSRVYQSLA

NLIRWSDQVMLEGVNSEDKEMVTTVKGVIKAVLDGVK - UNI8258 - - UNI20901 - - UNI30961 - ELVRLTIEKQGRPSPTSPVKPSSP

ASKPDG - UNI17804 - - UNI20901 - GQPELPLTDREMEILNKTTSVSPSAELLPDSTSEEVAPPKPPLPGIRVVDNS - UNI17804 - S

PPALPPKKRQSAPSPTRVAVVAPMSRATSGSSLPVGINRQ DFDVECYTQRRLSGGSRSCGGESPRLSPCSSTGKLSRSDEQLSSLDRDSGQCSRNTSCE

TLD DHYDPDYEFLQQDLSNADQIPPQAACNLSPLPESLGESGPPFLGHPFQLPLGSCLQQEGQQTDTPPALPEKKRRSAVSQTTDSSGCRVSYERHPSQ

YDNISEGDLQNPVPVQPVPYPPFAAVLPFQQGASSASAEFVGDFSVPELAGDTEKPPPLPEKKNKHM MLAYMQLLEDYSEPQPSMFYQTPQSEHIYQQK

NKMLMEVYGFSESFCGSDSTQELAPPPALPPKQRQL - UNI17809 - EPPSGKDGHPRDPSVSSASGKDSRENGER RSPKSLDGLESAQSEEEVDE

LSLIDHNEIMARLTLKQE - UNI25162 - GDDGPDVRGGSGDILLVHATETDRKD - UNI36332 - DLVLYCEAFLTTYRTFISPEELIKKLQY

R - UNI24327 - RYEKFSPFADTFKKRVSKNTFFVLVRVVDELC - UNI24327 - CLVELTEEILKLLMELVFRLVCSGELSLARVLRKNILDK

VDQKKLLRCAHSDQPLAARGVAAR RPGTLHDFHSHEIAEQLTLLDAELFYKIE IPEVLLWAKEQNEEKSPNLTQFTEHFNNMSYW WVRSIIMLQEKA

QDRERLLLKFIKIMK HLRKLNNFNSYLAILSALDSAPIRRLEWQRQTSE GLAEYCTLIDSSSSFRAYRAALSEVEPPCIPYL LGLILQDLTFVHLGN

PDYIDGKVNFSKRWQQFNILDSMRCFQQA AHYEIRRNDDIINFFNDFSDHLAEEALWELSLKIKPRNITRRKTDREEKT
Transcript ENSMUST00000091146
Sequence
GGGCTTCCGGCAGGTGGCGCCGTGGCCGCGGGGCCCAGGCCGGCGGGCGGGCGGCGGCGCGGCGCTGCGGCCGGCGGCTCGCGGCCCCGGAGCGGCGGCT

GCGCGGGAGGTGGAGCGGCGGAGTGGCAGGCCCGGTGCGGGCTGGAGCGCGGGCGGCGAGCGCACGAGCCGCGGCCGCGCGGAGCCCGCCATGACGGCGC

GAGTGTGAGGCGCGGCGAGCACCGGTCCAGTAGAGCGGCGGGCGCGCCGGCCTCTTATCCCGCAGCGGCCGGGCCGGGCCCTGATGAGCAGCGGCCTCGG

CCTCCGGCGCAGCCCGGAAATGTCCGGCAAGATCGAGAAAGCAG - UNI5122 - - UNI13709 - - UNI15349 - ACTCTCAGCGTTCTCAT

CTCTCCTCCTTCACCATGAAGCTGATGGACAAATTCCACTCTCCCAAAATCAAGAGAACACCATCCAAGAAGGGAAAGCCAGCCGAGGTGTCGAAGATTC

CTGAGAAGCCTGTGAGCAAA - UNI3468 - - UNI24459 - - UNI26155 - AACCTGTGCTGGCTGGAGGAGAAAGAGAAGGAGGTTGTCAG

TGCCTTGCGCTACTTTAAGACCATTGTGGACAAAATGGCCATTGATAAGAAGGTTCTGGAGATGCTCCCGGGGTCAGCCAGCAAGGTGCTGGAGGCCATC

TTACCCCTGGTGCAGACTGACCCTCGGATCCAGCACAG - UNI24459 - - UNI36004 - CTCAGCCCTCTCCTCCTGTTATAGCCGAGTATACC

AGAGCCTCGCCAACCTTATCCGATGGTCTGACCAGGTGATGCTAGAGGGCGTGAACTCAGAAGATAAGGAGATGGTGACAACTGTGAAGGGCGTTATCAA

AGCTGTCCTGGACGGAGTGAAG - UNI8258 - - UNI20901 - - UNI30961 - GAGCTAGTGAGGCTAACCATTGAGAAGCAGGGGCGGCCA

TCGCCAACAAGCCCAGTGAAGCCCAGTTCCCCAGCCAGCAAGCCTGATGG - UNI17804 - - UNI20901 - CCAGCCTGAGCTCCCTCTGACAG

ACCGAGAAATGGAGATTCTGAACAAGACGACAAGTGTGTCACCATCTGCTGAACTGCTCCCAGACTCCACCAGTGAAGAGGTCGCACCCCCCAAGCCCCC

TTTACCTGGCATCCGGGTGGTTGATAACAG - UNI17804 - TCCACCAGCATTACCACCCAAGAAAAGGCAGTCTGCTCCATCCCCCACTCGGGTGG

CTGTGGTAGCCCCAATGAGTCGGGCTACCAGTGGCTCCAGTTTGCCTGTTGGAATCAATAGGCAG GACTTTGATGTTGAATGTTACACCCAGAGGCGCC

TGTCAGGAGGCAGCCGCTCCTGCGGTGGTGAGTCTCCTCGCCTGTCCCCCTGCAGCAGCACAGGCAAGCTCAGCCGCTCAGACGAGCAGCTGTCCTCCCT

GGACAGGGATAGTGGGCAGTGCTCACGGAACACAAGCTGTGAAACACTAG ATCACTACGACCCCGACTATGAATTCCTCCAGCAAGATCTCTCCAATGC

AGACCAGATCCCTCCACAGGCAGCCTGTAACCTCAGCCCTCTGCCGGAGTCCCTGGGGGAATCTGGGCCTCCATTTCTTGGCCACCCTTTCCAGCTGCCT

TTGGGCAGCTGTCTGCAGCAGGAGGGACAGCAGACAGACACTCCACCTGCCCTTCCGGAGAAGAAGCGTAGGAGCGCAGTCTCCCAGACCACGGACAGCT

CTGGCTGCAGGGTGTCCTATGAGCGACACCCCTCACAGTATGACAACATCTCAGAGGGTGACCTGCAGAACCCAGTCCCAGTCCAGCCTGTGCCCTACCC

ACCCTTTGCTGCTGTCCTGCCCTTTCAGCAGGGAGCTTCCTCTGCCTCTGCTGAGTTTGTGGGTGATTTCAGTGTTCCTGAGTTGGCGGGTGACACAGAG

AAGCCACCTCCTCTACCAGAGAAGAAGAACAAGCACA TGCTGGCCTACATGCAACTGCTGGAGGACTACTCAGAGCCACAGCCCTCCATGTTCTACCAG

ACACCGCAGAGTGAGCACATCTACCAGCAGAAGAACAAGATGCTCATGGAGGTGTACGGCTTCAGCGAGTCCTTCTGCGGTAGTGATTCCACGCAGGAGC

TGGCCCCTCCACCCGCTCTGCCCCCCAAGCAACGGCAGCTG CAGGCCTCCTATGCTGCTTCTTCCTTCTCTGTCTCCTACTGTGTCCAGCAAACTAAAG

TGGCCTTCACCCCCGAGGACGGCAGTGCCGCTCAGGGCCTCAGTGTATCCGTGTCTAACTCCTTTCTCAACCGGCACGGCAGCTTGCCTGTGCCCTCG T

ACAAATCTGTGTTTAGGTCTTACTCCCAGGACTTCATGCCTCACCACCAAGCCTCCGTCCAACCTTTCCTTCCGCCTACCTCCTCTTCCTCTCCACATTT

CCCACCTGTCCACACGTCCCAGAGCTCGGACTTAGCGGTGCCCACCGTAAGCAGTCCGCCTCCCAGCACCGTGGACGGGCCTCTCTCGTCTTCTCAGGAC

AGCAGCTTTCATGGGAACCCTGTCCGCCTTCCTTCCGAAACCTCTTTCACTGACTCG AGTGAAAAGGCCAGCAGTGAGGAAGCTGGTGGGGATGAGTAT

GTCAGTCTGTACTCCTCTGGCCAGACCAGCGAGGAGCTGGCTCCCTGTCGAGGA - UNI17809 - GAACCACCATCTGGGAAGGACGGACATCCCAG

AGATCCTTCGGTCAGCAGTGCATCTGGGAAGGACAGCAGAGAAAATGGGGAAAG GTCCCCAAAGTCACTGGATGGTCTGGAGTCAGCGCAGTCAGAAGA

GGAAGTGGATGAACTGTCCCTCATTGACCACAATGAAATTATGGCCAGGCTGACACTCAAGCAAGAG - UNI25162 - GGTGATGATGGGCCAGATG

TTCGTGGTGGTTCAGGAGACATCTTACTGGTCCATGCTACTGAGACAGACAGAAAAG - UNI36332 - ACCTGGTGCTGTACTGTGAAGCCTTCCTG

ACCACCTACAGGACCTTCATCAGCCCGGAGGAGCTCATCAAGAAGCTGCAGTACCG - UNI24327 - GTACGAGAAGTTCTCTCCCTTTGCTGACAC

GTTCAAGAAGCGAGTGAGCAAGAACACATTCTTTGTGCTGGTTCGAGTGGTGGATGAGCTCTG - UNI24327 - CCTGGTGGAGCTGACAGAGGAGA

TCCTGAAGCTGCTGATGGAGCTGGTCTTCCGCCTAGTGTGCAGCGGAGAGCTCAGCCTGGCCAGAGTCCTCCGGAAGAACATTCTGGACAAGGTGGACCA

GAAGAAGCTGCTCAGGTGTGCCCATTCCGACCAGCCTCTGGCAGCCAGGGGTGTTGCAGCCAG GCCAGGAACCTTGCATGATTTCCACAGCCACGAGAT

AGCTGAGCAGCTGACACTGCTGGATGCCGAGCTTTTCTACAAGATAGAG ATTCCTGAAGTTTTGCTTTGGGCCAAAGAGCAGAATGAGGAGAAGAGTCC

CAATCTGACCCAGTTCACAGAGCACTTCAACAACATGTCCTACTG GGTGCGGTCCATCATCATGCTGCAGGAGAAGGCCCAGGACCGGGAGAGGCTGCT

CCTCAAGTTCATCAAGATCATGAAG CACCTGCGCAAGCTCAACAACTTCAACTCCTACCTGGCCATCCTCTCAGCACTAGACTCGGCCCCCATCCGCAG

ACTGGAGTGGCAGCGGCAGACCTCAGAG GGCCTGGCTGAGTACTGCACATTGATTGACAGCTCATCCTCCTTCCGAGCCTACCGGGCTGCTCTCTCAGA

GGTGGAGCCCCCATGTATCCCATACCT AGGTCTGATTCTGCAAGACCTGACCTTCGTTCACCTGGGAAACCCAGATTATATTGACGGGAAAGTAAACTT

CTCCAAGCGGTGGCAACAGTTCAACATATTGGACAGCATGCGGTGCTTCCAGCAGGC GCACTATGAAATCCGGAGAAACGACGACATCATAAATTTCTT

CAATGACTTCAGTGACCACCTGGCCGAGGAAGCCCTGTGGGAACTCTCTCTGAAGATCAAGCCTAGGAACATAACAAGGCGGAAAACAGACCGCGAAGAG

AAGACCTAGGAGCAGGCTGGCTGTGAGAACGCTCAAGCAGCCAGGAGAGGACCTGGACCATCCCAGCCTCAGCCTGTCCATGCCTGGCTGTGTGGCAGCA

CCTGAGTCTCCTGGCCGGTCTCCTGCCTCCTTCCCTATGGCTAAAGTCCCAGGGTTCACAATGAGCTGGCTGGCAGGCCTCAGGGCTGGCTTGTGTACTG

GTGGCCCCTGGTCTGGTTTTGTTTTCTGTTTTCTGTCAGTGCTCCCTCCTGTTCCCTCCTCTCCCCTGCAGCTGGAGAGCAGCAGACACCTGAGCAGCAG

ACCAGGGGAATGGCGGGCTTCACTGTCCCCAGGCCACCCTAGCCTCCTTAAGTGGCAGATAAGTAGGGGCCCCAGGACCCTTGGGTAGACTGCCCTCCGG

GACCCTGGAGCCAGGGGAGCTATGGCTGGGAGACAGAAGAAGGTAGAAAGGGACCACGCAGGCATCTTGTGCTGCCCACTTCCTGCTTTTTAAACATGGA

GGGAGAGGCATGTCAACCTGGCCCAGAAAGTATGGTGGGTGGTAGGCAAGAGCCACAGAGCTGACACTTCTCACAGCAGTGGCCCCAGCTCTGTCCTGCC

ATGCACGGCCACTAACCAAGGCACCTGCTGGGCTGACAGCAGCAGCACCAGTAGCACCTGTCGCCCACCACTGGTCCAGCCCCAGCCCCAGCCCCAGCCC

CAGCCCACATCACCGGTACTCTGGGGATCGGGAAGAGGAGGCAGAAGGGACAGTTCATGCTGAGCTGGGGCCAAGACTGTGCTTCAGAGAGTGAATAAGG

ATCTTCAGTGACCTAGGGAGAGGCAAGCAGCCCCTCCGTGCTTGCTGTGTGCCTTAAATGCCATCTCCTGTTCCTTCCAGGCCTGTGGGCTTCCCTCCTA

TTTTGCCCCACCCCCCGCAGCCAGCAGGTTCCTAGTCCCCGTTTGCTCTCTGGGAGTGTCTGTTCCCAAGAAGTCTAAGCAGGCCTAGGACGTGAGGGCC

TCCAGAGGTTTCCTGATTCCAGACAGGTGGCAGAGCCACCCCCTGCTGCTGAGGTTGACAATCTGTTCAGGGCTCAGGGCTAGGATCTCCCTGGGCATGG

CCCTGTGGCCACCACTGTGGGCTAAATGGCAGGGTGCAGTTCAGAATCCAGAGGTGCTGCTGGCCCTGCACCATACCTCCAATTAGCTTTGCATGGACAA

GCTCCCTTTTCTTCTGGTCGTGGGGCTTGGTCAAACGAATACCAGGATCTCTGCTTCCTCAACCAGTCCGCAGAGCAGAAGAAAAGACAGCAGCAGCTGC

TGGCCGGGTACTCGTTTGAAACAACTGTCACTCTGAACCCTCCTGGGTTTCGGGGTTTGTTTTTTTAGCAGCTTTTATCAAATAAGAACTGTGGGCCCCT

CTTCTGTTTATTTGTGCTGTAAATAGAGAGGGGACATCTGTAAACAGCCCCTTGGTCAGCTCCCTCTGGTGGCAGCCGGAATTGGATTGTTTAAGGAGTG

TGTGTGTGGAGTCCGGCTTGTGAGCAGTCATGTGGGTCTTTGGTTTGTTCCTCTTTTACAGGTCCTTTCATTTCAGTCTTTGCCCCTGCTTCCTGTCCTT

CACCAGCTCTAAGTGCTGCTGTGTGCAAGTGGGGAACACTGCACATGAGGTCCTTCCTCCCAGCGCTGTAGAGGCCCCTGCAGCCTCCCTGTGTAGCACA

GGCCTACCTGAGGCCTAGCCTACTGGTGCTGCAGCCAACAGAGTGGGTCTATGGTCTATGTCTACTGGTTCCCAAGCATGAGCTGGGCAGAAAGGAGGGC

TTACCTTCTAGACCCAGAATCACCAGGCCCTCCTATGATCCTGGGAGCCTTAGGCAGACTAAGTCAAGAGCCAGGACAGCTCTGGAGTTTCCGTGTGGGG

ATATCGAGGTGCGATGTGTGGGTTTAACTTATTAGCCAGCAGGCTTCCCCAGTCACCTGCCTCTGGCTGCGACTGAGCCCAGTGTTCAGGCAGCCTGGCT

TCCACATGTCTGTTTCTTAGTGGTGGGGTCTGGGAGAGCTGTGAAGATTCGTCTTTGTATACATACTAAGCAACATGGACAGTTGGGTTCCCAGCAGAGG

CCAGCCATTACCTGTGGGTAAGGCAAGCAAACACCGGATCTGGCTGGCCCTTAAGCCGAGACACCTGTTCCATGCCTCCCAGTGTGGCACTGTAATATAA

ACCCCCCACTAACCTGTCTGACAGTGCATCTTCCTACAGACAGAACAAGCGCGCAACTTTTATATGAAAGAAAAATAAACAGACAAAAGCCCATCTGATG

CC
Translation
MSSGLGLRRSPEMSGKIEKAD - UNI5122 - - UNI13709 - - UNI15349 - DSQRSHLSSFTMKLMDKFHSPKIKRTPSKKGKPAEVSKIP

EKPVSK - UNI3468 - - UNI24459 - - UNI26155 - NLCWLEEKEKEVVSALRYFKTIVDKMAIDKKVLEMLPGSASKVLEAILPLVQTDP

RIQHS - UNI24459 - - UNI36004 - SSALSSCYSRVYQSLANLIRWSDQVMLEGVNSEDKEMVTTVKGVIKAVLDGVK - UNI8258 - - 

UNI20901 - - UNI30961 - ELVRLTIEKQGRPSPTSPVKPSSPASKPDG - UNI17804 - - UNI20901 - GQPELPLTDREMEILNKTT

SVSPSAELLPDSTSEEVAPPKPPLPGIRVVDNS - UNI17804 - SPPALPPKKRQSAPSPTRVAVVAPMSRATSGSSLPVGINRQ DFDVECYTQRR

LSGGSRSCGGESPRLSPCSSTGKLSRSDEQLSSLDRDSGQCSRNTSCETLD DHYDPDYEFLQQDLSNADQIPPQAACNLSPLPESLGESGPPFLGHPFQ

LPLGSCLQQEGQQTDTPPALPEKKRRSAVSQTTDSSGCRVSYERHPSQYDNISEGDLQNPVPVQPVPYPPFAAVLPFQQGASSASAEFVGDFSVPELAGD

TEKPPPLPEKKNKHM MLAYMQLLEDYSEPQPSMFYQTPQSEHIYQQKNKMLMEVYGFSESFCGSDSTQELAPPPALPPKQRQL QASYAASSFSVSYCV

QQTKVAFTPEDGSAAQGLSVSVSNSFLNRHGSLPVPS YKSVFRSYSQDFMPHHQASVQPFLPPTSSSSPHFPPVHTSQSSDLAVPTVSSPPPSTVDGPL

SSSQDSSFHGNPVRLPSETSFTDS SEKASSEEAGGDEYVSLYSSGQTSEELAPCRG - UNI17809 - EPPSGKDGHPRDPSVSSASGKDSRENGER

 RSPKSLDGLESAQSEEEVDELSLIDHNEIMARLTLKQE - UNI25162 - GDDGPDVRGGSGDILLVHATETDRKD - UNI36332 - DLVLYCE

AFLTTYRTFISPEELIKKLQYR - UNI24327 - RYEKFSPFADTFKKRVSKNTFFVLVRVVDELC - UNI24327 - CLVELTEEILKLLMELVF

RLVCSGELSLARVLRKNILDKVDQKKLLRCAHSDQPLAARGVAAR RPGTLHDFHSHEIAEQLTLLDAELFYKIE IPEVLLWAKEQNEEKSPNLTQFTE

HFNNMSYW WVRSIIMLQEKAQDRERLLLKFIKIMK HLRKLNNFNSYLAILSALDSAPIRRLEWQRQTSE GLAEYCTLIDSSSSFRAYRAALSEVEPP

CIPYL LGLILQDLTFVHLGNPDYIDGKVNFSKRWQQFNILDSMRCFQQA AHYEIRRNDDIINFFNDFSDHLAEEALWELSLKIKPRNITRRKTDREEK

T
Transcript ENSMUST00000095087
Sequence
GGGCTTCCGGCAGGTGGCGCCGTGGCCGCGGGGCCCAGGCCGGCGGGCGGGCGGCGGCGCGGCGCTGCGGCCGGCGGCTCGCGGCCCCGGAGCGGCGGCT

GCGCGGGAGGTGGAGCGGCGGAGTGGCAGGCCCGGTGCGGGCTGGAGCGCGGGCGGCGAGCGCACGAGCCGCGGCCGCGCGGAGCCCGCCATGACGGCGC

GAGTGTGAGGCGCGGCGAGCACCGGTCCAGTAGAGCGGCGGGCGCGCCGGCCTCTTATCCCGCAGCGGCCGGGCCGGGCCCTGATGAGCAGCGGCCTCGG

CCTCCGGCGCAGCCCGGAAATGTCCGGCAAGATCGAGAAAGCAG - UNI5122 - - UNI13709 - - UNI15349 - ACTCTCAGCGTTCTCAT

CTCTCCTCCTTCACCATGAAGCTGATGGACAAATTCCACTCTCCCAAAATCAAGAGAACACCATCCAAGAAGGGAAAGCCAGCCGAGGTGTCGAAGATTC

CTGAGAAGCCTGTGAGCAAA - UNI26155 - GAGGCAAGAGACAGATTTCTACCAGAGGGCTACCCTATCCCCTTGGATCTGGAGCAGCAGGCAGTA

GAATTTATGTCCACCAGTGCTGTGGCTTCCAGGTCTCAGAGGCAGAAG - UNI3468 - - UNI24459 - - UNI26155 - AACCTGTGCTGGC

TGGAGGAGAAAGAGAAGGAGGTTGTCAGTGCCTTGCGCTACTTTAAGACCATTGTGGACAAAATGGCCATTGATAAGAAGGTTCTGGAGATGCTCCCGGG

GTCAGCCAGCAAGGTGCTGGAGGCCATCTTACCCCTGGTGCAGACTGACCCTCGGATCCAGCACAG - UNI24459 - - UNI36004 - CTCAGCC

CTCTCCTCCTGTTATAGCCGAGTATACCAGAGCCTCGCCAACCTTATCCGATGGTCTGACCAGGTGATGCTAGAGGGCGTGAACTCAGAAGATAAGGAGA

TGGTGACAACTGTGAAGGGCGTTATCAAAGCTGTCCTGGACGGAGTGAAG - UNI8258 - - UNI20901 - - UNI30961 - GAGCTAGTGAG

GCTAACCATTGAGAAGCAGGGGCGGCCATCGCCAACAAGCCCAGTGAAGCCCAGTTCCCCAGCCAGCAAGCCTGATGG - UNI17804 - - UNI209

01 - CCAGCCTGAGCTCCCTCTGACAGACCGAGAAATGGAGATTCTGAACAAGACGACAAGTGTGTCACCATCTGCTGAACTGCTCCCAGACTCCACCA

GTGAAGAGGTCGCACCCCCCAAGCCCCCTTTACCTGGCATCCGGGTGGTTGATAACAG - UNI17804 - TCCACCAGCATTACCACCCAAGAAAAGG

CAGTCTGCTCCATCCCCCACTCGGGTGGCTGTGGTAGCCCCAATGAGTCGGGCTACCAGTGGCTCCAGTTTGCCTGTTGGAATCAATAGGCAG GACTTT

GATGTTGAATGTTACACCCAGAGGCGCCTGTCAGGAGGCAGCCGCTCCTGCGGTGGTGAGTCTCCTCGCCTGTCCCCCTGCAGCAGCACAGGCAAGCTCA

GCCGCTCAGACGAGCAGCTGTCCTCCCTGGACAGGGATAGTGGGCAGTGCTCACGGAACACAAGCTGTGAAACACTAG ATCACTACGACCCCGACTATG

AATTCCTCCAGCAAGATCTCTCCAATGCAGACCAGATCCCTCCACAGGCAGCCTGTAACCTCAGCCCTCTGCCGGAGTCCCTGGGGGAATCTGGGCCTCC

ATTTCTTGGCCACCCTTTCCAGCTGCCTTTGGGCAGCTGTCTGCAGCAGGAGGGACAGCAGACAGACACTCCACCTGCCCTTCCGGAGAAGAAGCGTAGG

AGCGCAGTCTCCCAGACCACGGACAGCTCTGGCTGCAGGGTGTCCTATGAGCGACACCCCTCACAGTATGACAACATCTCAGAGGGTGACCTGCAGAACC

CAGTCCCAGTCCAGCCTGTGCCCTACCCACCCTTTGCTGCTGTCCTGCCCTTTCAGCAGGGAGCTTCCTCTGCCTCTGCTGAGTTTGTGGGTGATTTCAG

TGTTCCTGAGTTGGCGGGTGACACAGAGAAGCCACCTCCTCTACCAGAGAAGAAGAACAAGCACA TGCTGGCCTACATGCAACTGCTGGAGGACTACTC

AGAGCCACAGCCCTCCATGTTCTACCAGACACCGCAGAGTGAGCACATCTACCAGCAGAAGAACAAGATGCTCATGGAGGTGTACGGCTTCAGCGAGTCC

TTCTGCGGTAGTGATTCCACGCAGGAGCTGGCCCCTCCACCCGCTCTGCCCCCCAAGCAACGGCAGCTG CAGGCCTCCTATGCTGCTTCTTCCTTCTCT

GTCTCCTACTGTGTCCAGCAAACTAAAGTGGCCTTCACCCCCGAGGACGGCAGTGCCGCTCAGGGCCTCAGTGTATCCGTGTCTAACTCCTTTCTCAACC

GGCACGGCAGCTTGCCTGTGCCCTCG TACAAATCTGTGTTTAGGTCTTACTCCCAGGACTTCATGCCTCACCACCAAGCCTCCGTCCAACCTTTCCTTC

CGCCTACCTCCTCTTCCTCTCCACATTTCCCACCTGTCCACACGTCCCAGAGCTCGGACTTAGCGGTGCCCACCGTAAGCAGTCCGCCTCCCAGCACCGT

GGACGGGCCTCTCTCGTCTTCTCAGGACAGCAGCTTTCATGGGAACCCTGTCCGCCTTCCTTCCGAAACCTCTTTCACTGACTCG - UNI17809 - G

AACCACCATCTGGGAAGGACGGACATCCCAGAGATCCTTCGGTCAGCAGTGCATCTGGGAAGGACAGCAGAGAAAATGGGGAAAG GTCCCCAAAGTCAC

TGGATGGTCTGGAGTCAGCGCAGTCAGAAGAGGAAGTGGATGAACTGTCCCTCATTGACCACAATGAAATTATGGCCAGGCTGACACTCAAGCAAGAG -

 UNI25162 - GGTGATGATGGGCCAGATGTTCGTGGTGGTTCAGGAGACATCTTACTGGTCCATGCTACTGAGACAGACAGAAAAG - UNI36332 

- ACCTGGTGCTGTACTGTGAAGCCTTCCTGACCACCTACAGGACCTTCATCAGCCCGGAGGAGCTCATCAAGAAGCTGCAGTACCG - UNI24327 -

 GTACGAGAAGTTCTCTCCCTTTGCTGACACGTTCAAGAAGCGAGTGAGCAAGAACACATTCTTTGTGCTGGTTCGAGTGGTGGATGAGCTCTG - UNI

24327 - CCTGGTGGAGCTGACAGAGGAGATCCTGAAGCTGCTGATGGAGCTGGTCTTCCGCCTAGTGTGCAGCGGAGAGCTCAGCCTGGCCAGAGTCC

TCCGGAAGAACATTCTGGACAAGGTGGACCAGAAGAAGCTGCTCAGGTGTGCCCATTCCGACCAGCCTCTGGCAGCCAGGGGTGTTGCAGCCAG GCCAG

GAACCTTGCATGATTTCCACAGCCACGAGATAGCTGAGCAGCTGACACTGCTGGATGCCGAGCTTTTCTACAAGATAGAG ATTCCTGAAGTTTTGCTTT

GGGCCAAAGAGCAGAATGAGGAGAAGAGTCCCAATCTGACCCAGTTCACAGAGCACTTCAACAACATGTCCTACTG GGTGCGGTCCATCATCATGCTGC

AGGAGAAGGCCCAGGACCGGGAGAGGCTGCTCCTCAAGTTCATCAAGATCATGAAG CACCTGCGCAAGCTCAACAACTTCAACTCCTACCTGGCCATCC

TCTCAGCACTAGACTCGGCCCCCATCCGCAGACTGGAGTGGCAGCGGCAGACCTCAGAG GGCCTGGCTGAGTACTGCACATTGATTGACAGCTCATCCT

CCTTCCGAGCCTACCGGGCTGCTCTCTCAGAGGTGGAGCCCCCATGTATCCCATACCT AGGTCTGATTCTGCAAGACCTGACCTTCGTTCACCTGGGAA

ACCCAGATTATATTGACGGGAAAGTAAACTTCTCCAAGCGGTGGCAACAGTTCAACATATTGGACAGCATGCGGTGCTTCCAGCAGGC GCACTATGAAA

TCCGGAGAAACGACGACATCATAAATTTCTTCAATGACTTCAGTGACCACCTGGCCGAGGAAGCCCTGTGGGAACTCTCTCTGAAGATCAAGCCTAGGAA

CATAACAAGGCGGAAAACAGACCGCGAAGAGAAGACCTAGGAGCAGGCTGGCTGTGAGAACGCTCAAGCAGCCAGGAGAGGACCTGGACCATCCCAGCCT

CAGCCTGTCCATGCCTGGCTGTGTGGCAGCACCTGAGTCTCCTGGCCGGTCTCCTGCCTCCTTCCCTATGGCTAAAGTCCCAGGGTTCACAATGAGCTGG

CTGGCAGGCCTCAGGGCTGGCTTGTGTACTGGTGGCCCCTGGTCTGGTTTTGTTTTCTGTTTTCTGTCAGTGCTCCCTCCTGTTCCCTCCTCTCCCCTGC

AGCTGGAGAGCAGCAGACACCTGAGCAGCAGACCAGGGGAATGGCGGGCTTCACTGTCCCCAGGCCACCCTAGCCTCCTTAAGTGGCAGATAAGTAGGGG

CCCCAGGACCCTTGGGTAGACTGCCCTCCGGGACCCTGGAGCCAGGGGAGCTATGGCTGGGAGACAGAAGAAGGTAGAAAGGGACCACGCAGGCATCTTG

TGCTGCCCACTTCCTGCTTTTTAAACATGGAGGGAGAGGCATGTCAACCTGGCCCAGAAAGTATGGTGGGTGGTAGGCAAGAGCCACAGAGCTGACACTT

CTCACAGCAGTGGCCCCAGCTCTGTCCTGCCATGCACGGCCACTAACCAAGGCACCTGCTGGGCTGACAGCAGCAGCACCAGTAGCACCTGTCGCCCACC

ACTGGTCCAGCCCCAGCCCCAGCCCCAGCCCCAGCCCACATCACCGGTACTCTGGGGATCGGGAAGAGGAGGCAGAAGGGACAGTTCATGCTGAGCTGGG

GCCAAGACTGTGCTTCAGAGAGTGAATAAGGATCTTCAGTGACCTAGGGAGAGGCAAGCAGCCCCTCCGTGCTTGCTGTGTGCCTTAAATGCCATCTCCT

GTTCCTTCCAGGCCTGTGGGCTTCCCTCCTATTTTGCCCCACCCCCCGCAGCCAGCAGGTTCCTAGTCCCCGTTTGCTCTCTGGGAGTGTCTGTTCCCAA

GAAGTCTAAGCAGGCCTAGGACGTGAGGGCCTCCAGAGGTTTCCTGATTCCAGACAGGTGGCAGAGCCACCCCCTGCTGCTGAGGTTGACAATCTGTTCA

GGGCTCAGGGCTAGGATCTCCCTGGGCATGGCCCTGTGGCCACCACTGTGGGCTAAATGGCAGGGTGCAGTTCAGAATCCAGAGGTGCTGCTGGCCCTGC

ACCATACCTCCAATTAGCTTTGCATGGACAAGCTCCCTTTTCTTCTGGTCGTGGGGCTTGGTCAAACGAATACCAGGATCTCTGCTTCCTCAACCAGTCC

GCAGAGCAGAAGAAAAGACAGCAGCAGCTGCTGGCCGGGTACTCGTTTGAAACAACTGTCACTCTGAACCCTCCTGGGTTTCGGGGTTTGTTTTTTTAGC

AGCTTTTATCAAATAAGAACTGTGGGCCCCTCTTCTGTTTATTTGTGCTGTAAATAGAGAGGGGACATCTGTAAACAGCCCCTTGGTCAGCTCCCTCTGG

TGGCAGCCGGAATTGGATTGTTTAAGGAGTGTGTGTGTGGAGTCCGGCTTGTGAGCAGTCATGTGGGTCTTTGGTTTGTTCCTCTTTTACAGGTCCTTTC

ATTTCAGTCTTTGCCCCTGCTTCCTGTCCTTCACCAGCTCTAAGTGCTGCTGTGTGCAAGTGGGGAACACTGCACATGAGGTCCTTCCTCCCAGCGCTGT

AGAGGCCCCTGCAGCCTCCCTGTGTAGCACAGGCCTACCTGAGGCCTAGCCTACTGGTGCTGCAGCCAACAGAGTGGGTCTATGGTCTATGTCTACTGGT

TCCCAAGCATGAGCTGGGCAGAAAGGAGGGCTTACCTTCTAGACCCAGAATCACCAGGCCCTCCTATGATCCTGGGAGCCTTAGGCAGACTAAGTCAAGA

GCCAGGACAGCTCTGGAGTTTCCGTGTGGGGATATCGAGGTGCGATGTGTGGGTTTAACTTATTAGCCAGCAGGCTTCCCCAGTCACCTGCCTCTGGCTG

CGACTGAGCCCAGTGTTCAGGCAGCCTGGCTTCCACATGTCTGTTTCTTAGTGGTGGGGTCTGGGAGAGCTGTGAAGATTCGTCTTTGTATACATACTAA

GCAACATGGACAGTTGGGTTCCCAGCAGAGGCCAGCCATTACCTGTGGGTAAGGCAAGCAAACACCGGATCTGGCTGGCCCTTAAGCCGAGACACCTGTT

CCATGCCTCCCAGTGTGGCACTGTAATATAAACCCCCCACTAACCTGTCTGACAGTGCATCTTCCTACAGACAGAACAAGCGCGCAACTTTTATATGAAA

GAAAAATAAACAGACAAAAGCCCATCTGATGCC
Translation
MSSGLGLRRSPEMSGKIEKAD - UNI5122 - - UNI13709 - - UNI15349 - DSQRSHLSSFTMKLMDKFHSPKIKRTPSKKGKPAEVSKIP

EKPVSK - UNI26155 - EARDRFLPEGYPIPLDLEQQAVEFMSTSAVASRSQRQK - UNI3468 - - UNI24459 - - UNI26155 - NLC

WLEEKEKEVVSALRYFKTIVDKMAIDKKVLEMLPGSASKVLEAILPLVQTDPRIQHS - UNI24459 - - UNI36004 - SSALSSCYSRVYQSLA

NLIRWSDQVMLEGVNSEDKEMVTTVKGVIKAVLDGVK - UNI8258 - - UNI20901 - - UNI30961 - ELVRLTIEKQGRPSPTSPVKPSSP

ASKPDG - UNI17804 - - UNI20901 - GQPELPLTDREMEILNKTTSVSPSAELLPDSTSEEVAPPKPPLPGIRVVDNS - UNI17804 - S

PPALPPKKRQSAPSPTRVAVVAPMSRATSGSSLPVGINRQ DFDVECYTQRRLSGGSRSCGGESPRLSPCSSTGKLSRSDEQLSSLDRDSGQCSRNTSCE

TLD DHYDPDYEFLQQDLSNADQIPPQAACNLSPLPESLGESGPPFLGHPFQLPLGSCLQQEGQQTDTPPALPEKKRRSAVSQTTDSSGCRVSYERHPSQ

YDNISEGDLQNPVPVQPVPYPPFAAVLPFQQGASSASAEFVGDFSVPELAGDTEKPPPLPEKKNKHM MLAYMQLLEDYSEPQPSMFYQTPQSEHIYQQK

NKMLMEVYGFSESFCGSDSTQELAPPPALPPKQRQL QASYAASSFSVSYCVQQTKVAFTPEDGSAAQGLSVSVSNSFLNRHGSLPVPS YKSVFRSYSQ

DFMPHHQASVQPFLPPTSSSSPHFPPVHTSQSSDLAVPTVSSPPPSTVDGPLSSSQDSSFHGNPVRLPSETSFTDS - UNI17809 - EPPSGKDGHP

RDPSVSSASGKDSRENGER RSPKSLDGLESAQSEEEVDELSLIDHNEIMARLTLKQE - UNI25162 - GDDGPDVRGGSGDILLVHATETDRKD -

 UNI36332 - DLVLYCEAFLTTYRTFISPEELIKKLQYR - UNI24327 - RYEKFSPFADTFKKRVSKNTFFVLVRVVDELC - UNI24327 -

 CLVELTEEILKLLMELVFRLVCSGELSLARVLRKNILDKVDQKKLLRCAHSDQPLAARGVAAR RPGTLHDFHSHEIAEQLTLLDAELFYKIE IPEVL

LWAKEQNEEKSPNLTQFTEHFNNMSYW WVRSIIMLQEKAQDRERLLLKFIKIMK HLRKLNNFNSYLAILSALDSAPIRRLEWQRQTSE GLAEYCTLI

DSSSSFRAYRAALSEVEPPCIPYL LGLILQDLTFVHLGNPDYIDGKVNFSKRWQQFNILDSMRCFQQA AHYEIRRNDDIINFFNDFSDHLAEEALWEL

SLKIKPRNITRRKTDREEKT

For any suggestions or comments, please send an email to unitrap@crg.es