Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000039913 (Pak7)
Chromosomal location
Chr 2: 135907633 - 136213696 (-)
Description
p21 (CDKN1A)-activated kinase 7 Gene [Source:MGI (curated);Acc:Pak7-002]
RefSeq_dna
NM_172858 
RefSeq_peptide
NP_766446.2 
UniGene
Mm.131572 
MGI
MGI:1920334 
Uniprot/SWISSPROT
Q8C015 
Uniprot/SPTREMBL
B1AYC2 Q4KL59 Q8BVB0 
Human Ortholog
ENSG00000101349 (PAK7)
Omim not available
UniTrap UNI13904
Vector Insertion
Chr 2: 135907634 - 135909113
Public Clones CMHD-GT_194B11-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 93% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000035264
Sequence
GGAGCAGCTGAGTGGTCTCAGCGGACAGTCCTCCTAGGGGCGAAGCCAGGCGGCTTGGGCATGCTCAGTAGCTGGGAGAGGTTTGGGAGGAGAGTAAAAA

GCTTTGACTCTGCCCCCACCCCCTCCTCTAGCCCCCGCCCCCCTTGCCCCTTCCCAGCCGTAGTAGTTCCCTGGCGTGCGCCCGTGGAGAGCAGGAACAT

GGCGCTTGGAGCGATATAACAGATGTAGCAGCAGCGGAGAAGCAGATGAGGTACCGCGACTTCTCTGCTGACAGCCAGCCACCAG TAGAGAAGGTTTGC

AGTGCCAGAGATGATACAGTGAAGAATAGGCTTCCCTCCAGGCTGGCTCTTCAGCCACTAGCACTTTCTCAACCTTGCTACAGCCTCAGCATTTGTAAAT

TTGTAG AAATACACTGTGGTGAAATGCTTCTGTCTGTTGCCAAAATGAACACTGAAGAAAAATGAAGAAAACTGAAGAACACCAACAAAAAGTTTGCAC

AACAGAAGTAGCCAAACTCTTCTGGAATCTTTAATTCGTCCCCGGCCTTCGTAAAACAAAAA GTTTTTACATCATGTTTGGGAAGAAAAAGAAAAAGAT

CGAAATATCTGGCCCATCCAACTTTGAACACAGGGTTCATACTGGATTTGATCCACAAGAGCAGAAGTTTACTGGCCTTCCCCAGCAGTGGCACAGCCTG

TTAGCAGACACAGCCAACAGGCCCAAGCCCATGGTGGACCCATCATGCATCACACCCATACAGCTGGCTCCCATGAAG ACAATCGTCAGAGGAAATAAA

TCCTGCAAGGAAACCTCTATCAATGGTCTGCTAGAGGATTTTGACAACATCTCCGTGACTCGCTCCAACTCTCTAAGGAAAGAAAGCCCACCCACCCCAG

ATCAGGGAGCAGCTAGCCGCATTCAAGGCCACTCGGAAGAGAACGGCTTCATCACTTTCTCACAATATTCCAGTGAATCCGATACGACTGCGGACTACAC

AACTGAAAAGTACAGAGACAGGAGTCTCTATGGAGATGACCTGGATCTGTACTATAAAAGCAGCCATGCAGCCAAGCAAAATGGGCATGCCATGAAGATG

AAACATGGAGACGCTTACTACCCTGAGATGAAGTCTTTGAAAACCGACCTGGCCGGATTCCCTGTCGACTATCACACCCACTTGGACTCTCTGAGAAAAT

CAAGTGAATATGGTGACCTTAGGTGGGATTATCAGAGAGCCTCTAGTAGCTCCCCTCTGGACTACTCATTCCAGCTCACGCCTTCTAGAACTGCAGGGAC

CAGCAGGTGCTCCAAGGAGAGTCTGGCATACAGTGAAAGTGATTGGGGACCCAGCCTGGATGACTATGACAGGAGGCCAAAATCATCATACCTGCATCAG

ACGAGCCCTCAGCCAGCCATGCGCCAGAGATCCAAGTCCGGCTCAGGGCTTCAGGAACCCATGATGCCATTTGGAGCAAGTGCATTTAAAACTCATCCTC

AAGGACACTCGTACAACTCCTACACCTACCCTCGATTGTCCGAGCCCACAATGTGCATTCCAAAG GTGGATTACGATCGAGCACAGATGGTCTTCAGTC

CTCCACTGTCAGGGTCCGACACTTACCCCAGAGGCCCCACCAAACTACCTCAAAGTCAAAGCAAAGCAGGCTACTCTTCAGGCAGCCACCAGTACCCTTC

TGGGTACCACAAAGCATCTCTATACCACCATCCATCCCTGCAAACCAGTTCTCAGTACATCTCCACCGCTTCTTACTTAAGCTCTCTCAGTATCTCCTCG

AGCACCTACCCTCCACCTAGCTGGGGCTCCTCCTCAGACCAGCAGCCCTCAAGGGTATCCCATGAACAATTCCGAGCTGCCCTGCAACTGGTGGTCAGCC

CAGGAGACCCCAGGGAATATTTGGATAACTTTATTAAAATCGGAGAAGGGTCGACAGGCATCGTGTGCATTGCAACAGAGAAACACACAGGCAAGCAAGT

GGCAGTGAAGAAAATGGACCTCCGAAAGCAGCAGAGACGGGAACTCCTTTTTAATGAG GTCGTGATAATGCGTGATTACCACCATGACAACGTAGTTGA

CATGTACAACAGCTACCTTGTTGGAGATGAGCTCTGGGTGGTCATGGAGTTTCTAGAAGGTGGTGCCTTGACAGACATTGTCACTCATACCAG AATGAA

TGAAGAGCAGATAGCTACTGTCTGCCTGTCAGTTCTGAAAGCTCTGTCCTACCTTCATAACCAAGGAGTGATTCACAGGGACATAAAGAGTGACTCCATT

CTTCTGACAAGCGATGGCCGG ATAAAGTTATCTGACTTTGGTTTCTGTGCTCAAGTTTCCAAAGAGGTGCCAAAGAGGAAGTCACTGGTGGGTACCCCA

TACTGGATGGCACCTGAGGTGATTTCCAGGCTACCTTATGGGACAGAG GTGGACATCTGGTCCCTCGGGATAATGGTGATAGAGATGATTGATGGGGAG

CCCCCCTATTTCAATGAGCCTCCTCTGCAGGCCATGAGGAGGATCCGGGACAGTTTACCTCCAAGAGTGAAGGACCTACACAAG - UNI13904 - GT

TTCTTCCATGCTCCGAGGATTCCTAGATCTTATGTTGGTGAGGGAGCCCTCTCAAAGAGCCACAGCTCAAGAACTCCTTGGACATCCATTCTTAAAATTG

GCAGGTCCACCATCTTGCATTGTTCCTCTCATGAGACAATACAGACATCACTGAGAGGATTCACACAGGATGCAAAGCTAGGCAAAGACATGAGAATGAT

TCAGGAGAACATGAGGAAACCCACAGAACATGCAAAGACCTGTGCTTTCTAAACCAGCTGATTGGTGGAACAGTGTGATGACCTGACCGGCAGGGTTCGA

CAGACCAGGGCATCTTCTAGTGTCTTAAATAATAGGCATCTCTCCACTGACAGCTGGCATGGTCATTTGGAGCATGGCTTTAATTAATAAGTCATTATTA

TACATTTTCAGCCCTTCCAGTAAATCAGAAGGACTCAGTACAAACTCCGTTACGATATATCCTAGCCACATGCAGGGTACCACATAGGATTTTCTATATT

GAAAGAATACTTTTCTGGCAAAATAAAAAAAAAAAAGATAAAGAAAGGAAGAAAAGAAAATAAAAAGCACTTTTTTTCTTAATGGTAGCAGTGTAATGTA

TTTTGCAATGAATTTGTAACTTTTCTGTACGATAGTTTTGATAATTTATAGTACTTTGATGTCACGTAGCCATTGTCTCGGTTGAAGTAACACTTGTTTA

CTAGCAGGAGTTTGAACAAAGCCTTTCCTACTTTTTTATCCCTTTCAGAGAACCAACGATTCTTTAGGAACTTTGAATACTAAATGACCCTCAGTCACCG

TCAGCTTTAGCAGAATATCTTTCTTATCTTAACAAGTGTCTTATGTAGTGGAAGAAGAGTTAGGAGGGATGGTGATGGTGCGGACACTTCGCTTACCCAG

CCAAATATAACAAAATAAAATTTGAGCCACAGAATCGCCAAACGATTCCTTGAGATAATGCTAAGTATTTTGAAAAATTACATTTCCTTCAAGGATTCTG

GGAACACCCCATTGGTTTTTTTTGTAGAGCAAGATATTTCCCTTGATGCCCACCTTCAAATAGGCATGGCATCCTCAGTGGCCAAATTTCCCTCCCAGGG

AGTAATTTTAGCGCTGGGATCTTTGGACTCAGATCTCCAGGTAGAATGTTTCAGTGAGACCATGGAAATACCAGGCTCACAAAGGGAGAATGAACAAGGC

AAGTTGTTTGGTTTTGTCCGTCACTGTTTCTAAGACTTTGTATGCTAGCACACCAAACTCTTGTCTGTATTTACCTTCATGCCACAGTATTTATCACTGT

TATTCATGTATTGTGCGGAAAGTCTGAACGGATGATAGAGGATGAATTAGCAAGGGGGTACTTTACCAAGTATGGTCTAACTTCAGTGGTGACCATGTTA

TAATGTGTTTCTGACATAAGGAGAGTTGTGCTGCTGTCTCGATCTTCCTGAATGTTGATAAAAATGAATGACTACT
Translation
   MFGKKKKKIEISGPSNFEHRVHTGFDPQEQKFTGLPQQWHSLLADTANRPKPMVDPSCITPIQLAPMK TIVRGNKSCKETSINGLLEDFDNISVTR

SNSLRKESPPTPDQGAASRIQGHSEENGFITFSQYSSESDTTADYTTEKYRDRSLYGDDLDLYYKSSHAAKQNGHAMKMKHGDAYYPEMKSLKTDLAGFP

VDYHTHLDSLRKSSEYGDLRWDYQRASSSSPLDYSFQLTPSRTAGTSRCSKESLAYSESDWGPSLDDYDRRPKSSYLHQTSPQPAMRQRSKSGSGLQEPM

MPFGASAFKTHPQGHSYNSYTYPRLSEPTMCIPK VDYDRAQMVFSPPLSGSDTYPRGPTKLPQSQSKAGYSSGSHQYPSGYHKASLYHHPSLQTSSQYI

STASYLSSLSISSSTYPPPSWGSSSDQQPSRVSHEQFRAALQLVVSPGDPREYLDNFIKIGEGSTGIVCIATEKHTGKQVAVKKMDLRKQQRRELLFNE 

VVIMRDYHHDNVVDMYNSYLVGDELWVVMEFLEGGALTDIVTHTR RMNEEQIATVCLSVLKALSYLHNQGVIHRDIKSDSILLTSDGR IKLSDFGFCA

QVSKEVPKRKSLVGTPYWMAPEVISRLPYGTE VDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDSLPPRVKDLHK - UNI13904 - VSSMLRGF

LDLMLVREPSQRATAQELLGHPFLKLAGPPSCIVPLMRQYRHH
Transcript ENSMUST00000077200
Sequence
CAGCGGGCTGCTCCTAAAACCCGGAGCAGCTGAGTGGTCTCAGCGGACAGTCCTCCTAGGGGCGAAGCCAGGCGGCTTGGGCATGCTCAGTAGCTGGGAG

AGGTTTGGGAGGAGAGTAAAAAGCTTTGACTCTGCCCCCACCCCCTCCTCTAGCCCCCGCCCCCCTTGCCCCTTCCCAGCCGTAGTAGTTCCCTGGCGTG

CGCCCGTGGAGAGCAGGAACATGGCGCTTGGAGCGATATAACAGATGTAGCAGCAGCGGAGAAGCAGATGAGGTACCGCGACTTCTCTGCTGACAGCCAG

CCACCAG AAATACACTGTGGTGAAATGCTTCTGTCTGTTGCCAAAATGAACACTGAAGAAAAATGAAGAAAACTGAAGAACACCAACAAAAAGTTTGCA

CAACAGAAGTAGCCAAACTCTTCTGGAATCTTTAATTCGTCCCCGGCCTTCGTAAAACAAAAA GTTTTTACATCATGTTTGGGAAGAAAAAGAAAAAGA

TCGAAATATCTGGCCCATCCAACTTTGAACACAGGGTTCATACTGGATTTGATCCACAAGAGCAGAAGTTTACTGGCCTTCCCCAGCAGTGGCACAGCCT

GTTAGCAGACACAGCCAACAGGCCCAAGCCCATGGTGGACCCATCATGCATCACACCCATACAGCTGGCTCCCATGAAG ACAATCGTCAGAGGAAATAA

ATCCTGCAAGGAAACCTCTATCAATGGTCTGCTAGAGGATTTTGACAACATCTCCGTGACTCGCTCCAACTCTCTAAGGAAAGAAAGCCCACCCACCCCA

GATCAGGGAGCAGCTAGCCGCATTCAAGGCCACTCGGAAGAGAACGGCTTCATCACTTTCTCACAATATTCCAGTGAATCCGATACGACTGCGGACTACA

CAACTGAAAAGTACAGAGACAGGAGTCTCTATGGAGATGACCTGGATCTGTACTATAAAAGCAGCCATGCAGCCAAGCAAAATGGGCATGCCATGAAGAT

GAAACATGGAGACGCTTACTACCCTGAGATGAAGTCTTTGAAAACCGACCTGGCCGGATTCCCTGTCGACTATCACACCCACTTGGACTCTCTGAGAAAA

TCAAGTGAATATGGTGACCTTAGGTGGGATTATCAGAGAGCCTCTAGTAGCTCCCCTCTGGACTACTCATTCCAGCTCACGCCTTCTAGAACTGCAGGGA

CCAGCAGGTGCTCCAAGGAGAGTCTGGCATACAGTGAAAGTGATTGGGGACCCAGCCTGGATGACTATGACAGGAGGCCAAAATCATCATACCTGCATCA

GACGAGCCCTCAGCCAGCCATGCGCCAGAGATCCAAGTCCGGCTCAGGGCTTCAGGAACCCATGATGCCATTTGGAGCAAGTGCATTTAAAACTCATCCT

CAAGGACACTCGTACAACTCCTACACCTACCCTCGATTGTCCGAGCCCACAATGTGCATTCCAAAG GTGGATTACGATCGAGCACAGATGGTCTTCAGT

CCTCCACTGTCAGGGTCCGACACTTACCCCAGAGGCCCCACCAAACTACCTCAAAGTCAAAGCAAAGCAGGCTACTCTTCAGGCAGCCACCAGTACCCTT

CTGGGTACCACAAAGCATCTCTATACCACCATCCATCCCTGCAAACCAGTTCTCAGTACATCTCCACCGCTTCTTACTTAAGCTCTCTCAGTATCTCCTC

GAGCACCTACCCTCCACCTAGCTGGGGCTCCTCCTCAGACCAGCAGCCCTCAAGGGTATCCCATGAACAATTCCGAGCTGCCCTGCAACTGGTGGTCAGC

CCAGGAGACCCCAGGGAATATTTGGATAACTTTATTAAAATCGGAGAAGGGTCGACAGGCATCGTGTGCATTGCAACAGAGAAACACACAGGCAAGCAAG

TGGCAGTGAAGAAAATGGACCTCCGAAAGCAGCAGAGACGGGAACTCCTTTTTAATGAG GTCGTGATAATGCGTGATTACCACCATGACAACGTAGTTG

ACATGTACAACAGCTACCTTGTTGGAGATGAGCTCTGGGTGGTCATGGAGTTTCTAGAAGGTGGTGCCTTGACAGACATTGTCACTCATACCAG AATGA

ATGAAGAGCAGATAGCTACTGTCTGCCTGTCAGTTCTGAAAGCTCTGTCCTACCTTCATAACCAAGGAGTGATTCACAGGGACATAAAGAGTGACTCCAT

TCTTCTGACAAGCGATGGCCGG ATAAAGTTATCTGACTTTGGTTTCTGTGCTCAAGTTTCCAAAGAGGTGCCAAAGAGGAAGTCACTGGTGGGTACCCC

ATACTGGATGGCACCTGAGGTGATTTCCAGGCTACCTTATGGGACAGAG GTGGACATCTGGTCCCTCGGGATAATGGTGATAGAGATGATTGATGGGGA

GCCCCCCTATTTCAATGAGCCTCCTCTGCAGGCCATGAGGAGGATCCGGGACAGTTTACCTCCAAGAGTGAAGGACCTACACAAG - UNI13904 - G

TTTCTTCCATGCTCCGAGGATTCCTAGATCTTATGTTGGTGAGGGAGCCCTCTCAAAGAGCCACAGCTCAAGAACTCCTTGGACATCCATTCTTAAAATT

GGCAGGTCCACCATCTTGCATTGTTCCTCTCATGAGACAATACAGACATCACTGAGAGGATTCACACAGGATGCAAAGCTAGGCAAAGACATGAGAATGA

TTCAGGAGAACATGAGGAAACCCACAGAACATGCAAAGACCTGTGCTTTCTAAACCAGCTGATTGGTGGAACAGTGTGATGACCTGACCGGCAGGGTTCG

ACAGACCAGGGCATCTTCTAGTGTCTTAAATAATAGGCATCTCTCCACTGACAGCTGGCATGGTCATTTGGAGCATGGCTTTAATTAATAAGTCATTATT

ATACATTTTCAGCCCTTCCAGTAAATCAGAAGGACTCAGTACAAACTCCGTTACGATATATCCTAGCCACATGCAGGGTACCACATAGGATTTTCTATAT

TGAAAGAATACTTTTCTGGCAAAATAAAAAAAAAAAAGATAAAGAAAGGAAGAAAAGAAAATAAAAAGCACTTTTTTTCTTAATGGTAGCAGTGTAATGT

ATTTTGCAATGAATTTGTAACTTTTCTGTACGATAGTTTTGATAATTTATAGTACTTTGATGTCACGTAGCCATTGTCTCGGTTGAAGTAACACTTGTTT

ACTAGCAGGAGTTTGAACAAAGCCTTTCCTACTTTTTTATCCCTTTCAGAGAACCAACGATTCTTTAGGAACTTTGAATACTAAATGACCCTCAGTCACC

GTCAGCTTTAGCAGAATATCTTTCTTATCTTAACAAGTGTCTTATGTAGTGGAAGAAGAGTTAGGAGGGATGGTGATGGTGCGGACACTTCGCTTACCCA

GCCAAATATAACAAAATAAAATTTGAGCCACAGAATCGCCAAACGATTCCTTGAGATAATGCTAAGTATTTTGAAAAATTACATTTCCTTCAAGGATTCT

GGGAACACCCCATTGGTTTTTTTTGTAGAGCAAGATATTTCCCTTGATGCCCACCTTCAAATAGGCATGGCATCCTCAGTGGCCAAATTTCCCTCCCAGG

GAGTAATTTTAGCGCTGGGATCTTTGGACTCAGATCTCCAGGTAGAATGTTTCAGTGAGACCATGGAAATACCAGGCTCACAAAGGGAGAATGAACAAGG

CAAGTTGTTTGGTTTTGTCCGTCACTGTTTCTAAGACTTTGTATGCTAGCACACCAAACTCTTGTCTGTATTTACCTTCATGCCACAGTATTTATCACTG

TTATTCATGTATTGTGCGGAAAGTCTGAACGGATGATAGAGGATGAATTAGCAAGGGGGTACTTTACCAAGTATGGTCTAACTTCAGTGGTGACCATGTT

ATAATGTGTTTCTGACATAAGGAGAGTTGTGCTGCTGTCTCGATCTTCCTGAATGTTGATAAAAATGAATGACTACTAC
Translation
  MFGKKKKKIEISGPSNFEHRVHTGFDPQEQKFTGLPQQWHSLLADTANRPKPMVDPSCITPIQLAPMK TIVRGNKSCKETSINGLLEDFDNISVTRS

NSLRKESPPTPDQGAASRIQGHSEENGFITFSQYSSESDTTADYTTEKYRDRSLYGDDLDLYYKSSHAAKQNGHAMKMKHGDAYYPEMKSLKTDLAGFPV

DYHTHLDSLRKSSEYGDLRWDYQRASSSSPLDYSFQLTPSRTAGTSRCSKESLAYSESDWGPSLDDYDRRPKSSYLHQTSPQPAMRQRSKSGSGLQEPMM

PFGASAFKTHPQGHSYNSYTYPRLSEPTMCIPK VDYDRAQMVFSPPLSGSDTYPRGPTKLPQSQSKAGYSSGSHQYPSGYHKASLYHHPSLQTSSQYIS

TASYLSSLSISSSTYPPPSWGSSSDQQPSRVSHEQFRAALQLVVSPGDPREYLDNFIKIGEGSTGIVCIATEKHTGKQVAVKKMDLRKQQRRELLFNE V

VIMRDYHHDNVVDMYNSYLVGDELWVVMEFLEGGALTDIVTHTR RMNEEQIATVCLSVLKALSYLHNQGVIHRDIKSDSILLTSDGR IKLSDFGFCAQ

VSKEVPKRKSLVGTPYWMAPEVISRLPYGTE VDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDSLPPRVKDLHK - UNI13904 - VSSMLRGFL

DLMLVREPSQRATAQELLGHPFLKLAGPPSCIVPLMRQYRHH

For any suggestions or comments, please send an email to unitrap@crg.es