Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000039943 (Plcb4)
Chromosomal location
Chr 2: 135567566 - 135840329 (+)
Description
phospholipase C, beta 4 Gene [Source:MGI (curated);Acc:Plcb4-002]
RefSeq_dna
NM_013829 
RefSeq_peptide
NP_038857.1 
UniGene
Mm.405299 Mm.38009 
MGI
MGI:107464 
Uniprot/SPTREMBL
Q6P8L2 Q8BXH1 Q91UZ1 Q9Z2T3 A2AT91 Q5FWA6 A2AT93 
Human Ortholog
ENSG00000101333 (PLCB4)
Omim not available
UniTrap UNI14299
Vector Insertion
Chr 2: 135567624 - 135631283
Public Clones FHCRC-GT-S20-4H1 (fhcrc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30985
Vector Insertion
Chr 2: 135567624 - 135631284
Public Clones (sanger) 5SD103B08 (ggtc) 3SE112G04 (ggtc) 3SE065F04 (ggtc) IST14845C3 (tigm)
IST14914D9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16552
Vector Insertion
Chr 2: 135631283 - 135631342
Public Clones not available
Private Clones OST458617 (lexicon) OST318529 (lexicon) OST314577 (lexicon) OST306617 (lexicon)
OST290599 (lexicon) OST211748 (lexicon) OST199623 (lexicon) OST184713 (lexicon)
OST106873 (lexicon) OST96619 (lexicon) OST67601 (lexicon) OST65743 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29646
Vector Insertion
Chr 2: 135631342 - 135703118
Public Clones E127G07 (ggtc) Ayu21-T234 (egtc) IST10672B8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19132
Vector Insertion
Chr 2: 135703118 - 135703218
Public Clones not available
Private Clones OST403783 (lexicon) OST368333 (lexicon) OST331505 (lexicon) OST326628 (lexicon)
OST323491 (lexicon) OST310174 (lexicon) OST289296 (lexicon) OST275295 (lexicon)
OST61451 (lexicon) OST44577 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26956
Vector Insertion
Chr 2: 135733316 - 135734085
Public Clones not available
Private Clones OST82636 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1476
Vector Insertion
Chr 2: 135735836 - 135735981
Public Clones CD0291 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10641
Vector Insertion
Chr 2: 135765741 - 135772781
Public Clones A035C03 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000035646
Sequence
GGGACTGTGCAGGATTTGATCGGGTAGACCTCCCTTGCTTGCTGCTCCCAGCTGCCTG - UNI16552 - - UNI19132 - - UNI29646 - GT

CTTGAATACCATCATGGCCAAACCTTACGAATTTAACTGGCAGAAGGAAGTGCCCTCTTTCTTGCAAGAAGGAGCAGTTTTTGACAGATACGAAGAG - 

UNI19132 - GAATCTTTTGTGTTTGAGCCCAACTGCCTCTTCAAAGTAGATGAATTCGGCTTCTTCCTGACGTGGAAGAGTGAAGGCAAG - UNI26

956 - GAAGGACAAGTGCTAGAATGTTCCCTCATCAACAGTATTCGCCAAGCAGCCATACCAAAG - UNI1476 - GATCCCAAAATCCTGGCTGCT

CTCGAAGCTGTTGGAAAATCTGAAAATGATCTGGAAGGGCGGATATTGTGTGTCTGCAGCGGCACGGATCTGGTGAATATCGGCTTCACTTACATGGTGG

CTGAAAATCCAGAAGTAACTAAG - UNI1476 - CAATGGGTAGAAGGCCTGAGATCGATCATTCACAACTTCAGGGCAAACAACGTCAGTCCGATGA

CATGCCTCAAGAAACA CTGGATGAAACTGGCCTTTCTGACCAACACAACTGGTAAAATCCCAGTGAGGAG TATCACTAGAACCTTCGCATCAGGGAAA

ACAGAAAAGGTGATCTTTCAAGCCCTCAAGGAACTAGGTCTTCCCAGTGGAAAG AATGATGAAATTGAACCTGCTGCATTTACTTATGAAAAGTTCTAT

GAACTGACACAAAAGATTTGTCCTCGGACAGATATAGAAGATCTTTTTAAAAAAAT CAATGGAGACAAAACTGATTATTTAACGGTAGACCAATTAGTG

AGCTTTCTAAACGAA - UNI10641 - CATCAGCGAGATCCTCGGCTGAATGAAATTTTATTCCCATTTTATGATGCTAAAAGAGCAATGCAGATCAT

TGAAATGTATGAGCCTGATGAAGAGCTGAAGAAAAAAG GCCTCATATCCAGTGATGGATTCTGCAGATATCTGATGTCAGATGAAAATGCCCCTGTCTT

CTTAGATCGCTTAGAACTTTACCAGGAGATGGACCACCCGCTGGCTCATTACTTCATCAGTTCCTCCCACAACACCTATCTCACTGGCCGGCAATTTGGA

GGAAAGTCTTCAGTGGAAATGTACAGACAAGTTCTCCTGGCTGGTTGCAG GTGTGTTGAACTTGACTGTTGGGATGGAAAAGGTGAAGATCAGGAACCG

ATAATAACTCACGGAAAAGCAATGTGTACAGACATCCTTTTTAAG GATGTAATCCAGGCCATCAAGGAAACGGCGTTTGTCACATCAGAATACCCTGTC

ATTCTCTCCTTCGAAAACCACTGCAG CAAATATCAACAGTACAAGATGTCCAAGTATTGTGAAGATCTATTTGGGGATCTCCTGTTGAAACAAGCACTT

GAGTCGCATCCA CTTGAACCAGGAAGGCCCTTGCCGTCTCCTAATGACCTCAAAAGAAAAATACTCATCAAGAATAAGAGGCTGAAGCCTGAAGTTGAA

AAGA AACAGCTTGAAGCTTTGAAAAGCATGATGGAAGCTGGAGAGTCAGCCGCCCCAGCTAGCATCTTGGAAGACGACAATGAAGAGGAAATAGAAAGT

G CTGATCAAGAGGAAGAAGCCCACCCTGAATACAAATTTGGAAATGAACTTTCTGCCGATGACTACAGTCACAAGGAAGCGGTTGCAAACAGCGTCAAG

AAG GGCCTGGTCACCGTAGAGGATGAGCAAGCATGGATGGCATCTTATAAATACGTAGGTGCTACCACGAACATCCATCCGTACTTGTCCACGATGATC

AACTATGCCCAGCCCGTGAAGTTTCAAGGTTTCCACGTGGCTGAAG AGCGCAATATTCACTATAACATGTCTTCTTTTAACGAGTCGGTTGGCCTTGGC

TACTTGAAGACGCACGCGATTGAGTTTGTAAA TTACAATAAGCGACAAATGAGCCGCATTTACCCCAAGGGAGGCCGAGTTGATTCCAGTAATTACATG

CCTCAGATTTTCTGGAACGCTGGTTGCCAGATGGTTTCACTGAACTATCAAACCCCAG ATTTAGCGATGCAATTGAATCAAGGAAAATTTGAGTATAAT

GGATCATGCGG GTACCTTCTCAAGCCAGATTTCATGAGGCGGCCTGATCGGACATTTGACCCCTTCTCTGAAACCCCTGTGGACGGGGTTATTGCAGCC

ACGTGCTCAGTGCAG GTTATATCAGGGCAGTTCCTCTCAGATAAGAAGATCGGGACATACGTGGAAGTCGATATGTACGGGCTGCCCACCGACACCATA

CGGAAAGAGTTCCGAACCCGCATGGTTATGAACAATGGACTCAACCCAGTGTATAATGAAGAATCGTTTGTGTTTCGAAAG GTGATCCTGCCTGACCTA

GCTGTCCTGAGAATCGCAGTCTACGATGACAACAACAAGCTAATTGGCCAGAGGATCCTTCCTTTGGATGGTCTCCAAGCAGGCTACCGACACATCTCCC

TGAGAAACGAGGGAAACAAACCATTATCACTGCCAACAATTTTCTGCAATATTGTTCTTAAAACATACGTGCCTGATGGATTTGGAG ATATTGTGGATG

CTTTATCCGATCCAAAGAAATTTCTTTCAATCACAGAGAAGAGAGCAGACCAAATGAGAGCAATGGGCATTGAAACT AGTGACATAGCAGATGTGCCCA

GTGACACTTCCAAAAATGACAAGAAAGGCAAGGCCAACCCAGCCAAAGCGAACGTGACCCCTCAGAGCAGCTCTGAGCTCAGACCAACCACCACAGCCGC

CCTGGGCTCTGGCCAGGAAGCCAAGAAAG GTATTGAACTTATCCCTCAAGTGAGGATAGAAGATTTAAAGCAAATGAAG GCTTACTTGAAGCATTTAA

AGAAACAACAGAAGGAGTTAAACTCTTTAAAGAAGAAACATGCAAAG GAGCACAGTACCATGCAGAAGTTACACTGCACACAAGTTGACAAAATCGTGG

CCCAGTATGACAAAGAGAAGTCGACTCATGAGAAAATCCTAGAGAAGGCGATGAAGAAGAAGGG GGGAAGTAATTGTCTTGAAATAAAAAAAGAAACAG

AAATTAAAATTCAGACCCTGACAACGGATCACAAATCTAAG GTCAAAGAGATTGTGGCCCAGCACACAAAGGAGTGGTCAGAAATGATCAACACTCACA

GTGCGGAGGAGCAGGAAATCCGGGATCTGCACCTGAGCCAGCAGTGTGAGCTGCTGAGAAAGCTGCTCATCAATGCTCATGAGCAGCAGACCCAGCAGCT

GAAACTCTCCCATGACAG GGAAAGCAAGGAGATGAGAGCCCATCAGGCTAAGATTTCTATGGAAAATAGCAAGGCCATCAGTCAAGATAAATCTATCAA

GAACAAGGCAGAACGGGAAAG GCGAGTCAGGGAGTTGAACAGCAGCAACACTAAGAAGTTCCTAGAAGAAAGAAAGAGA CTGGCGATGAAGCAGTCAA

AAGAAATGGATCAGTTGAAAAAAGTCCAGCTGGAGCACCTAGAATTCCTAGAGAAACAGAACGAGCAG GCGAAGGAGATGCAGCAGATGGTGAAATTGG

AAGCCGAGATGGACCGCAGACCAGCAACAGTAGTATGAAACTCCAGAGTGCAAACTGAAGCTGGAAGACCAT
Translation
 - UNI16552 - - UNI19132 - - UNI29646 - MAKPYEFNWQKEVPSFLQEGAVFDRYEE - UNI19132 - ESFVFEPNCLFKVDEFGF

FLTWKSEGK - UNI26956 - EGQVLECSLINSIRQAAIPK - UNI1476 - DPKILAALEAVGKSENDLEGRILCVCSGTDLVNIGFTYMVAENP

EVTK - UNI1476 - QWVEGLRSIIHNFRANNVSPMTCLKKH HWMKLAFLTNTTGKIPVRS SITRTFASGKTEKVIFQALKELGLPSGK NDEIEP

AAFTYEKFYELTQKICPRTDIEDLFKKI INGDKTDYLTVDQLVSFLNE - UNI10641 - HQRDPRLNEILFPFYDAKRAMQIIEMYEPDEELKKKG

 GLISSDGFCRYLMSDENAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCR RCVELDCWDGKGEDQEPIITHGKAMCT

DILFK DVIQAIKETAFVTSEYPVILSFENHCS SKYQQYKMSKYCEDLFGDLLLKQALESHP LEPGRPLPSPNDLKRKILIKNKRLKPEVEKK KQLE

ALKSMMEAGESAAPASILEDDNEEEIESA ADQEEEAHPEYKFGNELSADDYSHKEAVANSVKK GLVTVEDEQAWMASYKYVGATTNIHPYLSTMINYA

QPVKFQGFHVAEE ERNIHYNMSSFNESVGLGYLKTHAIEFVN NYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPD DLAMQLNQGKFE

YNGSCG GYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQ VISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRK V

ILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGD DIVDALSDPKKFLSITEKRADQMRAMGIET 

SDIADVPSDTSKNDKKGKANPAKANVTPQSSSELRPTTTAALGSGQEAKKG GIELIPQVRIEDLKQMK AYLKHLKKQQKELNSLKKKHAK EHSTMQK

LHCTQVDKIVAQYDKEKSTHEKILEKAMKKKG GGSNCLEIKKETEIKIQTLTTDHKSK VKEIVAQHTKEWSEMINTHSAEEQEIRDLHLSQQCELLRK

LLINAHEQQTQQLKLSHDR RESKEMRAHQAKISMENSKAISQDKSIKNKAERER RRVRELNSSNTKKFLEERKR LAMKQSKEMDQLKKVQLEHLEFL

EKQNEQ AKEMQQMVKLEAEMDRRPATVV
Transcript ENSMUST00000110109
Sequence
GAGCCTGCTTTGTGCGTGCTGTCAACTACCTGGGAGGATTCTCGACACAGCAGCCTGG - UNI14299 - - UNI16552 - - UNI30985 - GG

ACTGTGCAGGATTTGATCGGGTAGACCTCCCTTGCTTGCTGCTCCCAGCTGCCTG - UNI16552 - - UNI19132 - - UNI29646 - GTCTT

GAATACCATCATGGCCAAACCTTACGAATTTAACTGGCAGAAGGAAGTGCCCTCTTTCTTGCAAGAAGGAGCAGTTTTTGACAGATACGAAGAG - UNI

19132 - GAATCTTTTGTGTTTGAGCCCAACTGCCTCTTCAAAGTAGATGAATTCGGCTTCTTCCTGACGTGGAAGAGTGAAGGCAAG - UNI26956

 - GAAGGACAAGTGCTAGAATGTTCCCTCATCAACAGTATTCGCCAAGCAGCCATACCAAAG - UNI1476 - GATCCCAAAATCCTGGCTGCTCTC

GAAGCTGTTGGAAAATCTGAAAATGATCTGGAAGGGCGGATATTGTGTGTCTGCAGCGGCACGGATCTGGTGAATATCGGCTTCACTTACATGGTGGCTG

AAAATCCAGAAGTAACTAAG - UNI1476 - CAATGGGTAGAAGGCCTGAGATCGATCATTCACAACTTCAGGGCAAACAACGTCAGTCCGATGACAT

GCCTCAAGAAACA CTGGATGAAACTGGCCTTTCTGACCAACACAACTGGTAAAATCCCAGTGAGGAG TATCACTAGAACCTTCGCATCAGGGAAAACA

GAAAAGGTGATCTTTCAAGCCCTCAAGGAACTAGGTCTTCCCAGTGGAAAG AATGATGAAATTGAACCTGCTGCATTTACTTATGAAAAGTTCTATGAA

CTGACACAAAAGATTTGTCCTCGGACAGATATAGAAGATCTTTTTAAAAAAAT CAATGGAGACAAAACTGATTATTTAACGGTAGACCAATTAGTGAGC

TTTCTAAACGAA - UNI10641 - CATCAGCGAGATCCTCGGCTGAATGAAATTTTATTCCCATTTTATGATGCTAAAAGAGCAATGCAGATCATTGA

AATGTATGAGCCTGATGAAGAGCTGAAGAAAAAAG GCCTCATATCCAGTGATGGATTCTGCAGATATCTGATGTCAGATGAAAATGCCCCTGTCTTCTT

AGATCGCTTAGAACTTTACCAGGAGATGGACCACCCGCTGGCTCATTACTTCATCAGTTCCTCCCACAACACCTATCTCACTGGCCGGCAATTTGGAGGA

AAGTCTTCAGTGGAAATGTACAGACAAGTTCTCCTGGCTGGTTGCAG GTGTGTTGAACTTGACTGTTGGGATGGAAAAGGTGAAGATCAGGAACCGATA

ATAACTCACGGAAAAGCAATGTGTACAGACATCCTTTTTAAG GATGTAATCCAGGCCATCAAGGAAACGGCGTTTGTCACATCAGAATACCCTGTCATT

CTCTCCTTCGAAAACCACTGCAG CAAATATCAACAGTACAAGATGTCCAAGTATTGTGAAGATCTATTTGGGGATCTCCTGTTGAAACAAGCACTTGAG

TCGCATCCA CTTGAACCAGGAAGGCCCTTGCCGTCTCCTAATGACCTCAAAAGAAAAATACTCATCAAGAATAAGAGGCTGAAGCCTGAAGTTGAAAAG

A AACAGCTTGAAGCTTTGAAAAGCATGATGGAAGCTGGAGAGTCAGCCGCCCCAGCTAGCATCTTGGAAGACGACAATGAAGAGGAAATAGAAAGTG C

TGATCAAGAGGAAGAAGCCCACCCTGAATACAAATTTGGAAATGAACTTTCTGCCGATGACTACAGTCACAAGGAAGCGGTTGCAAACAGCGTCAAGAAG

 GGCCTGGTCACCGTAGAGGATGAGCAAGCATGGATGGCATCTTATAAATACGTAGGTGCTACCACGAACATCCATCCGTACTTGTCCACGATGATCAAC

TATGCCCAGCCCGTGAAGTTTCAAGGTTTCCACGTGGCTGAAG AGCGCAATATTCACTATAACATGTCTTCTTTTAACGAGTCGGTTGGCCTTGGCTAC

TTGAAGACGCACGCGATTGAGTTTGTAAA TTACAATAAGCGACAAATGAGCCGCATTTACCCCAAGGGAGGCCGAGTTGATTCCAGTAATTACATGCCT

CAGATTTTCTGGAACGCTGGTTGCCAGATGGTTTCACTGAACTATCAAACCCCAG ATTTAGCGATGCAATTGAATCAAGGAAAATTTGAGTATAATGGA

TCATGCGG GTACCTTCTCAAGCCAGATTTCATGAGGCGGCCTGATCGGACATTTGACCCCTTCTCTGAAACCCCTGTGGACGGGGTTATTGCAGCCACG

TGCTCAGTGCAG GTTATATCAGGGCAGTTCCTCTCAGATAAGAAGATCGGGACATACGTGGAAGTCGATATGTACGGGCTGCCCACCGACACCATACGG

AAAGAGTTCCGAACCCGCATGGTTATGAACAATGGACTCAACCCAGTGTATAATGAAGAATCGTTTGTGTTTCGAAAG GTGATCCTGCCTGACCTAGCT

GTCCTGAGAATCGCAGTCTACGATGACAACAACAAGCTAATTGGCCAGAGGATCCTTCCTTTGGATGGTCTCCAAGCAGGCTACCGACACATCTCCCTGA

GAAACGAGGGAAACAAACCATTATCACTGCCAACAATTTTCTGCAATATTGTTCTTAAAACATACGTGCCTGATGGATTTGGAG ATATTGTGGATGCTT

TATCCGATCCAAAGAAATTTCTTTCAATCACAGAGAAGAGAGCAGACCAAATGAGAGCAATGGGCATTGAAACT AGTGACATAGCAGATGTGCCCAGTG

ACACTTCCAAAAATGACAAGAAAGGCAAGGCCAACCCAGCCAAAGCGAACGTGACCCCTCAGAGCAGCTCTGAGCTCAGACCAACCACCACAGCCGCCCT

GGGCTCTGGCCAGGAAGCCAAGAAAG GTATTGAACTTATCCCTCAAGTGAGGATAGAAGATTTAAAGCAAATGAAG GCTTACTTGAAGCATTTAAAGA

AACAACAGAAGGAGTTAAACTCTTTAAAGAAGAAACATGCAAAG GAGCACAGTACCATGCAGAAGTTACACTGCACACAAGTTGACAAAATCGTGGCCC

AGTATGACAAAGAGAAGTCGACTCATGAGAAAATCCTAGAGAAGGCGATGAAGAAGAAGGG GGGAAGTAATTGTCTTGAAATAAAAAAAGAAACAGAAA

TTAAAATTCAGACCCTGACAACGGATCACAAATCTAAG GTCAAAGAGATTGTGGCCCAGCACACAAAGGAGTGGTCAGAAATGATCAACACTCACAGTG

CGGAGGAGCAGGAAATCCGGGATCTGCACCTGAGCCAGCAGTGTGAGCTGCTGAGAAAGCTGCTCATCAATGCTCATGAGCAGCAGACCCAGCAGCTGAA

ACTCTCCCATGACAG GGAAAGCAAGGAGATGAGAGCCCATCAGGCTAAGATTTCTATGGAAAATAGCAAGGCCATCAGTCAAGATAAATCTATCAAGAA

CAAGGCAGAACGGGAAAG GCGAGTCAGGGAGTTGAACAGCAGCAACACTAAGAAGTTCCTAGAAGAAAGAAAGAGA CTGGCGATGAAGCAGTCAAAAG

AAATGGATCAGTTGAAAAAAGTCCAGCTGGAGCACCTAGAATTCCTAGAGAAACAGAACGAGCAG GCGAAGGAGATGCAGCAGATGGTGAAATTGGAAG

CCGAGATGGACCGCAGACCAGCAACAGTAGTATGAAACTCCAGAGTGCAAACTGAAGCTGGAAGACCATGCAACACCAGAAGATCATGCCCAGCTTCCAA

ACACAGACTCCACAGACAAAAGCTGTTTTCTTTGTGTTTCTTTTATGTATAGACACGGTGTTACCTGAAACCACATGGACTGGGGATGACCAAACGCTCT

TATATTTAACAATTTGAGTATTGAATTTCTTTGGCCAACCAAAAGTAGCTATGTACACATACACACACACACATACACACACACACACAGAGAGAGAGAG

AGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAAATCCCCTATTCCTGACAGGCAGAGTTGAATCATGATATATGACTTAAACATGTTTGCTATGAGA

CAGCATCACAAGCCAGTGGGCTTGGTGATAACAACTCTGCTTTGTGGTGCATTAGGACATGTTTGAGCTGCTGCTGCTGCAAAACAAAACAAAACAAAAA

AATTAGTGCATTAGTAACTTAATAGTAAGCGCATGCACTAGAAGAAACACCTCTGTCTCCAGTTCATTAGCAGAAGTGGCCGTCTGCTATACAAATCACT

TCGCAGAATTTTCTACACCTAAGTTACCTCATCAGTAAGTGCCATGTCTTTACCATGCCATAAGATGCTAACCTTCCTGTAAATGTTGCAGAAATCGTTA

GGACAATAGAGACACAAAACGGTGTATCTGTGCCAAGCTCATCAATGCTCCCAGGGGGACTCGGCAGGCTCGTTTCAGAAAGTTTACAGCTGACCCTGCT

TTGTAGGAATTGCTTCTGCCGATTCCACATATTGCAATTCACTCTACACTATAAGGATCGTCAAGTGGTTATTGGCAAATGTTTGTAAATGTGACCATGT

ACAAAGTATTTATACTCCTTAATTCTCACAGTTATAGCTCAAAGTCATCTAAATATTACCACACGACAAGACTAGTGAGCAGGAATCATAGACGTAATGT

TTTGCATGATGCACAAGCACCAATTATGACTAACCCATTCAAACACAGTTAACCTAACACCAAATAAATACTGGTTAAGTAAATGTACGGCACAGAATAT

TATTTGACTATCAAGACTTTTAGCATAATGAAAAAGTCTATATATATGTGTATATGAATTATGTGGGCATTCTTGATACTTCAAGTTCTAGTTTGAAAAA

TACATAACTAATTTAATTTTACACAAAAATATTTATGCAGATTTTCAGACTTTCATATCAGGAAATAACCTTTTTATGTCTGTTAAATATCCAAACAATT

TGCTACCGTGTTAATCTGCATGGTCTTCTCGCCTGCTGTAGTTGCCTTGCAGGTGTCTCATAAAGTGGACCGATGGGATGGAGTCATGCTGCCCAAACTC

AGAGGAGCATGCAGGGATCCGGTAGCCTAGCAAGAGTCAGATTCCTGATTTTAGAATACAAAATGCCAACTTAATTGTTGTATATGGTTGTACAAATAGA

TTCTGTACCTTCCTCTGAAGAGGGCAGAGAAGATTATGATACCATGAAGGCTAAAATTCAATGTACAACTTCTCTAATAAAAAATGAAAACACA
Translation
 - UNI14299 - - UNI16552 - - UNI30985 -  - UNI16552 - - UNI19132 - - UNI29646 - MAKPYEFNWQKEVPSFLQEG

AVFDRYEE - UNI19132 - ESFVFEPNCLFKVDEFGFFLTWKSEGK - UNI26956 - EGQVLECSLINSIRQAAIPK - UNI1476 - DPKI

LAALEAVGKSENDLEGRILCVCSGTDLVNIGFTYMVAENPEVTK - UNI1476 - QWVEGLRSIIHNFRANNVSPMTCLKKH HWMKLAFLTNTTGKI

PVRS SITRTFASGKTEKVIFQALKELGLPSGK NDEIEPAAFTYEKFYELTQKICPRTDIEDLFKKI INGDKTDYLTVDQLVSFLNE - UNI10641

 - HQRDPRLNEILFPFYDAKRAMQIIEMYEPDEELKKKG GLISSDGFCRYLMSDENAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSV

EMYRQVLLAGCR RCVELDCWDGKGEDQEPIITHGKAMCTDILFK DVIQAIKETAFVTSEYPVILSFENHCS SKYQQYKMSKYCEDLFGDLLLKQALE

SHP LEPGRPLPSPNDLKRKILIKNKRLKPEVEKK KQLEALKSMMEAGESAAPASILEDDNEEEIESA ADQEEEAHPEYKFGNELSADDYSHKEAVAN

SVKK GLVTVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEE ERNIHYNMSSFNESVGLGYLKTHAIEFVN NYNKRQMSRIYPKGGR

VDSSNYMPQIFWNAGCQMVSLNYQTPD DLAMQLNQGKFEYNGSCG GYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQ VISGQFLSDKKIGTYVE

VDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRK VILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKT

YVPDGFGD DIVDALSDPKKFLSITEKRADQMRAMGIET SDIADVPSDTSKNDKKGKANPAKANVTPQSSSELRPTTTAALGSGQEAKKG GIELIPQV

RIEDLKQMK AYLKHLKKQQKELNSLKKKHAK EHSTMQKLHCTQVDKIVAQYDKEKSTHEKILEKAMKKKG GGSNCLEIKKETEIKIQTLTTDHKSK 

VKEIVAQHTKEWSEMINTHSAEEQEIRDLHLSQQCELLRKLLINAHEQQTQQLKLSHDR RESKEMRAHQAKISMENSKAISQDKSIKNKAERER RRVR

ELNSSNTKKFLEERKR LAMKQSKEMDQLKKVQLEHLEFLEKQNEQ AKEMQQMVKLEAEMDRRPATVV
Transcript ENSMUST00000110108
Sequence
GGGACTGTGCAGGATTTGATCGGGTAGACCTCCCTTGCTTGCTGCTCCCAGCTGCCTG - UNI16552 - - UNI19132 - - UNI29646 - GT

CTTGAATACCATCATGGCCAAACCTTACGAATTTAACTGGCAGAAGGAAGTGCCCTCTTTCTTGCAAGAAGGAGCAGTTTTTGACAGATACGAAGAG - 

UNI19132 - GAATCTTTTGTGTTTGAGCCCAACTGCCTCTTCAAAGTAGATGAATTCGGCTTCTTCCTGACGTGGAAGAGTGAAGGCAAG - UNI26

956 - GAAGGACAAGTGCTAGAATGTTCCCTCATCAACAGTATTCGCCAAGCAGCCATACCAAAG - UNI1476 - GATCCCAAAATCCTGGCTGCT

CTCGAAGCTGTTGGAAAATCTGAAAATGATCTGGAAGGGCGGATATTGTGTGTCTGCAGCGGCACGGATCTGGTGAATATCGGCTTCACTTACATGGTGG

CTGAAAATCCAGAAGTAACTAAG - UNI1476 - CAATGGGTAGAAGGCCTGAGATCGATCATTCACAACTTCAGGGCAAACAACGTCAGTCCGATGA

CATGCCTCAAGAAACA CTGGATGAAACTGGCCTTTCTGACCAACACAACTGGTAAAATCCCAGTGAGGAG TATCACTAGAACCTTCGCATCAGGGAAA

ACAGAAAAGGTGATCTTTCAAGCCCTCAAGGAACTAGGTCTTCCCAGTGGAAAG AATGATGAAATTGAACCTGCTGCATTTACTTATGAAAAGTTCTAT

GAACTGACACAAAAGATTTGTCCTCGGACAGATATAGAAGATCTTTTTAAAAAAAT CAATGGAGACAAAACTGATTATTTAACGGTAGACCAATTAGTG

AGCTTTCTAAACGAA - UNI10641 - CATCAGCGAGATCCTCGGCTGAATGAAATTTTATTCCCATTTTATGATGCTAAAAGAGCAATGCAGATCAT

TGAAATGTATGAGCCTGATGAAGAGCTGAAGAAAAAAG GCCTCATATCCAGTGATGGATTCTGCAGATATCTGATGTCAGATGAAAATGCCCCTGTCTT

CTTAGATCGCTTAGAACTTTACCAGGAGATGGACCACCCGCTGGCTCATTACTTCATCAGTTCCTCCCACAACACCTATCTCACTGGCCGGCAATTTGGA

GGAAAGTCTTCAGTGGAAATGTACAGACAAGTTCTCCTGGCTGGTTGCAG GTGTGTTGAACTTGACTGTTGGGATGGAAAAGGTGAAGATCAGGAACCG

ATAATAACTCACGGAAAAGCAATGTGTACAGACATCCTTTTTAAG GATGTAATCCAGGCCATCAAGGAAACGGCGTTTGTCACATCAGAATACCCTGTC

ATTCTCTCCTTCGAAAACCACTGCAG CAAATATCAACAGTACAAGATGTCCAAGTATTGTGAAGATCTATTTGGGGATCTCCTGTTGAAACAAGCACTT

GAGTCGCATCCA CTTGAACCAGGAAGGCCCTTGCCGTCTCCTAATGACCTCAAAAGAAAAATACTCATCAAGAATAAGAGGCTGAAGCCTGAAGTTGAA

AAGA AACAGCTTGAAGCTTTGAAAAGCATGATGGAAGCTGGAGAGTCAGCCGCCCCAGCTAGCATCTTGGAAGACGACAATGAAGAGGAAATAGAAAGT

G CTGATCAAGAGGAAGAAGCCCACCCTGAATACAAATTTGGAAATGAACTTTCTGCCGATGACTACAGTCACAAGGAAGCGGTTGCAAACAGCGTCAAG

AAG ACCTCAGATGACCTTGAACATGAAAACAACAAAAAG GGCCTGGTCACCGTAGAGGATGAGCAAGCATGGATGGCATCTTATAAATACGTAGGTGC

TACCACGAACATCCATCCGTACTTGTCCACGATGATCAACTATGCCCAGCCCGTGAAGTTTCAAGGTTTCCACGTGGCTGAAG AGCGCAATATTCACTA

TAACATGTCTTCTTTTAACGAGTCGGTTGGCCTTGGCTACTTGAAGACGCACGCGATTGAGTTTGTAAA TTACAATAAGCGACAAATGAGCCGCATTTA

CCCCAAGGGAGGCCGAGTTGATTCCAGTAATTACATGCCTCAGATTTTCTGGAACGCTGGTTGCCAGATGGTTTCACTGAACTATCAAACCCCAG ATTT

AGCGATGCAATTGAATCAAGGAAAATTTGAGTATAATGGATCATGCGG GTACCTTCTCAAGCCAGATTTCATGAGGCGGCCTGATCGGACATTTGACCC

CTTCTCTGAAACCCCTGTGGACGGGGTTATTGCAGCCACGTGCTCAGTGCAG GTTATATCAGGGCAGTTCCTCTCAGATAAGAAGATCGGGACATACGT

GGAAGTCGATATGTACGGGCTGCCCACCGACACCATACGGAAAGAGTTCCGAACCCGCATGGTTATGAACAATGGACTCAACCCAGTGTATAATGAAGAA

TCGTTTGTGTTTCGAAAG GTGATCCTGCCTGACCTAGCTGTCCTGAGAATCGCAGTCTACGATGACAACAACAAGCTAATTGGCCAGAGGATCCTTCCT

TTGGATGGTCTCCAAGCAGGCTACCGACACATCTCCCTGAGAAACGAGGGAAACAAACCATTATCACTGCCAACAATTTTCTGCAATATTGTTCTTAAAA

CATACGTGCCTGATGGATTTGGAG ATATTGTGGATGCTTTATCCGATCCAAAGAAATTTCTTTCAATCACAGAGAAGAGAGCAGACCAAATGAGAGCAA

TGGGCATTGAAACT AGTGACATAGCAGATGTGCCCAGTGACACTTCCAAAA ATGAAAAAAAAAAAAAAAAAAAAAAA
Translation
 - UNI16552 - - UNI19132 - - UNI29646 - MAKPYEFNWQKEVPSFLQEGAVFDRYEE - UNI19132 - ESFVFEPNCLFKVDEFGF

FLTWKSEGK - UNI26956 - EGQVLECSLINSIRQAAIPK - UNI1476 - DPKILAALEAVGKSENDLEGRILCVCSGTDLVNIGFTYMVAENP

EVTK - UNI1476 - QWVEGLRSIIHNFRANNVSPMTCLKKH HWMKLAFLTNTTGKIPVRS SITRTFASGKTEKVIFQALKELGLPSGK NDEIEP

AAFTYEKFYELTQKICPRTDIEDLFKKI INGDKTDYLTVDQLVSFLNE - UNI10641 - HQRDPRLNEILFPFYDAKRAMQIIEMYEPDEELKKKG

 GLISSDGFCRYLMSDENAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCR RCVELDCWDGKGEDQEPIITHGKAMCT

DILFK DVIQAIKETAFVTSEYPVILSFENHCS SKYQQYKMSKYCEDLFGDLLLKQALESHP LEPGRPLPSPNDLKRKILIKNKRLKPEVEKK KQLE

ALKSMMEAGESAAPASILEDDNEEEIESA ADQEEEAHPEYKFGNELSADDYSHKEAVANSVKK TSDDLEHENNKK GLVTVEDEQAWMASYKYVGATT

NIHPYLSTMINYAQPVKFQGFHVAEE ERNIHYNMSSFNESVGLGYLKTHAIEFVN NYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPD

 DLAMQLNQGKFEYNGSCG GYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQ VISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNP

VYNEESFVFRK VILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGD DIVDALSDPKKFLSITEK

RADQMRAMGIET SDIADVPSDTSKN NEKKKKKKK
Transcript ENSMUST00000110106
Sequence
GGGACTGTGCAGGATTTGATCGGGTAGACCTCCCTTGCTTGCTGCTCCCAGCTGCCTG - UNI16552 - - UNI19132 - - UNI29646 - GT

CTTGAATACCATCATGGCCAAACCTTACGAATTTAACTGGCAGAAGGAAGTGCCCTCTTTCTTGCAAGAAGGAGCAGTTTTTGACAGATACGAAGAG - 

UNI19132 - GAATCTTTTGTGTTTGAGCCCAACTGCCTCTTCAAAGTAGATGAATTCGGCTTCTTCCTGACGTGGAAGAGTGAAGGCAAG - UNI26

956 - GAAGGACAAGTGCTAGAATGTTCCCTCATCAACAGTATTCGCCAAGCAGCCATACCAAAG - UNI1476 - GATCCCAAAATCCTGGCTGCT

CTCGAAGCTGTTGGAAAATCTGAAAATGATCTGGAAGGGCGGATATTGTGTGTCTGCAGCGGCACGGATCTGGTGAATATCGGCTTCACTTACATGGTGG

CTGAAAATCCAGAAGTAACTAAG - UNI1476 - CAATGGGTAGAAGGCCTGAGATCGATCATTCACAACTTCAGGGCAAACAACGTCAGTCCGATGA

CATGCCTCAAGAAACA CTGGATGAAACTGGCCTTTCTGACCAACACAACTGGTAAAATCCCAGTGAGGAG TATCACTAGAACCTTCGCATCAGGGAAA

ACAGAAAAGGTGATCTTTCAAGCCCTCAAGGAACTAGGTCTTCCCAGTGGAAAG AATGATGAAATTGAACCTGCTGCATTTACTTATGAAAAGTTCTAT

GAACTGACACAAAAGATTTGTCCTCGGACAGATATAGAAGATCTTTTTAAAAAAAT CAATGGAGACAAAACTGATTATTTAACGGTAGACCAATTAGTG

AGCTTTCTAAACGAA - UNI10641 - CATCAGCGAGATCCTCGGCTGAATGAAATTTTATTCCCATTTTATGATGCTAAAAGAGCAATGCAGATCAT

TGAAATGTATGAGCCTGATGAAGAGCTGAAGAAAAAAG GCCTCATATCCAGTGATGGATTCTGCAGATATCTGATGTCAGATGAAAATGCCCCTGTCTT

CTTAGATCGCTTAGAACTTTACCAGGAGATGGACCACCCGCTGGCTCATTACTTCATCAGTTCCTCCCACAACACCTATCTCACTGGCCGGCAATTTGGA

GGAAAGTCTTCAGTGGAAATGTACAGACAAGTTCTCCTGGCTGGTTGCAG GTGTGTTGAACTTGACTGTTGGGATGGAAAAGGTGAAGATCAGGAACCG

ATAATAACTCACGGAAAAGCAATGTGTACAGACATCCTTTTTAAG GATGTAATCCAGGCCATCAAGGAAACGGCGTTTGTCACATCAGAATACCCTGTC

ATTCTCTCCTTCGAAAACCACTGCAG CAAATATCAACAGTACAAGATGTCCAAGTATTGTGAAGATCTATTTGGGGATCTCCTGTTGAAACAAGCACTT

GAGTCGCATCCA CTTGAACCAGGAAGGCCCTTGCCGTCTCCTAATGACCTCAAAAGAAAAATACTCATCAAGAATAAGAGGCTGAAGCCTGAAGTTGAA

AAGA AACAGCTTGAAGCTTTGAAAAGCATGATGGAAGCTGGAGAGTCAGCCGCCCCAGCTAGCATCTTGGAAGACGACAATGAAGAGGAAATAGAAAGT

G CTGATCAAGAGGAAGAAGCCCACCCTGAATACAAATTTGGAAATGAACTTTCTGCCGATGACTACAGTCACAAGGAAGCGGTTGCAAACAGCGTCAAG

AAG GGCCTGGTCACCGTAGAGGATGAGCAAGCATGGATGGCATCTTATAAATACGTAGGTGCTACCACGAACATCCATCCGTACTTGTCCACGATGATC

AACTATGCCCAGCCCGTGAAGTTTCAAGGTTTCCACGTGGCTGAAG AGCGCAATATTCACTATAACATGTCTTCTTTTAACGAGTCGGTTGGCCTTGGC

TACTTGAAGACGCACGCGATTGAGTTTGTAAA TTACAATAAGCGACAAATGAGCCGCATTTACCCCAAGGGAGGCCGAGTTGATTCCAGTAATTACATG

CCTCAGATTTTCTGGAACGCTGGTTGCCAGATGGTTTCACTGAACTATCAAACCCCAG ATTTAGCGATGCAATTGAATCAAGGAAAATTTGAGTATAAT

GGATCATGCGG GTACCTTCTCAAGCCAGATTTCATGAGGCGGCCTGATCGGACATTTGACCCCTTCTCTGAAACCCCTGTGGACGGGGTTATTGCAGCC

ACGTGCTCAGTGCAG GTTATATCAGGGCAGTTCCTCTCAGATAAGAAGATCGGGACATACGTGGAAGTCGATATGTACGGGCTGCCCACCGACACCATA

CGGAAAGAGTTCCGAACCCGCATGGTTATGAACAATGGACTCAACCCAGTGTATAATGAAGAATCGTTTGTGTTTCGAAAG GTGATCCTGCCTGACCTA

GCTGTCCTGAGAATCGCAGTCTACGATGACAACAACAAGCTAATTGGCCAGAGGATCCTTCCTTTGGATGGTCTCCAAGCAGGCTACCGACACATCTCCC

TGAGAAACGAGGGAAACAAACCATTATCACTGCCAACAATTTTCTGCAATATTGTTCTTAAAACATACGTGCCTGATGGATTTGGAG ATATTGTGGATG

CTTTATCCGATCCAAAGAAATTTCTTTCAATCACAGAGAAGAGAGCAGACCAAATGAGAGCAATGGGCATTGAAACT AGTGACATAGCAGATGTGCCCA

GTGACACTTCCAAAAATGACAAGAAAGGCAAGGCCAACCCAGCCAAAGCGAACGTGACCCCTCAGAGCAGCTCTGAGCTCAGACCAACCACCACAGCCGC

CCTGGGCTCTGGCCAGGAAGCCAAGAAAG GTATTGAACTTATCCCTCAAGTGAGGATAGAAGATTTAAAGCAAATGAAG GCTTACTTGAAGCATTTAA

AGAAACAACAGAAGGAGTTAAACTCTTTAAAGAAGAAACATGCAAAG GAGCACAGTACCATGCAGAAGTTACACTGCACACAAGTTGACAAAATCGTGG

CCCAGTATGACAAAGAGAAGTCGACTCATGAGAAAATCCTAGAGAAGGCGATGAAGAAGAAGGG GGGAAGTAATTGTCTTGAAATAAAAAAAGAAACAG

AAATTAAAATTCAGACCCTGACAACGGATCACAAATCTAAG GTCAAAGAGATTGTGGCCCAGCACACAAAGGAGTGGTCAGAAATGATCAACACTCACA

GTGCGGAGGAGCAGGAAATCCGGGATCTGCACCTGAGCCAGCAGTGTGAGCTGCTGAGAAAGCTGCTCATCAATGCTCATGAGCAGCAGACCCAGCAGCT

GAAACTCTCCCATGACAG GGAAAGCAAGGAGATGAGAGCCCATCAGGCTAAGATTTCTATGGAAAATAGCAAGGCCATCAGTCAAGATAAATCTATCAA

GAACAAGGCAGAACGGGAAAG GCGAGTCAGGGAGTTGAACAGCAGCAACACTAAGAAGTTCCTAGAAGAAAGAAAGAGA CTGGCGATGAAGCAGTCAA

AAGAAATGGATCAGTTGAAAAAAGTCCAGCTGGAGCACCTAGAATTCCTAGAGAAACAGAACGAGCAG CTTTTGAAATCCTGTCATGCAGTGTCCCAAA

CACAAG GCGAAGGAGATGCAGCAGATGGTGAAATTGGAAGCCGAGATGGACCGCAGACCAGCAACAGTAGTATGAAACTCCAGAGTGCAAACTGAAGCT

GGAAGACCAT
Translation
 - UNI16552 - - UNI19132 - - UNI29646 -  - UNI19132 -  - UNI26956 -  - UNI1476 -  - UNI1476 -      -

 UNI10641 -                  MK AYLKHLKKQQKELNSLKKKHAK EHSTMQKLHCTQVDKIVAQYDKEKSTHEKILEKAMKKKG GGSNC

LEIKKETEIKIQTLTTDHKSK VKEIVAQHTKEWSEMINTHSAEEQEIRDLHLSQQCELLRKLLINAHEQQTQQLKLSHDR RESKEMRAHQAKISMENS

KAISQDKSIKNKAERER RRVRELNSSNTKKFLEERKR LAMKQSKEMDQLKKVQLEHLEFLEKQNEQ LLKSCHAVSQTQG GEGDAADGEIGSRDGPQ

TSNSSMKLQSAN

For any suggestions or comments, please send an email to unitrap@crg.es