Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040054 (Baz2a)
Chromosomal location
Chr 10: 127496046 - 127566359 (+)
Description
bromodomain adjacent to zinc finger domain, 2A Gene [Source:MGI Symbol;Acc:MGI:2151152]
RefSeq_dna
NM_054078 
RefSeq_peptide
NP_473419.2 
UniGene
Mm.252213 Mm.388624 Mm.409292 Mm.468597 
MGI
MGI:2151152 
Uniprot/SWISSPROT
Q91YE5 
Uniprot/SPTREMBL
Q05CX2 Q3U235 Q3UET2 Q3USB1 Q3UXC9 Q3V0H2 Q6PE75 Q80U42 Q80VL8 Q8BRP6 Q8CGH2 
Human Ortholog
ENSG00000076108 (BAZ2A)
Omim not available
UniTrap UNI20228
Vector Insertion
Chr 10: 127496083 - 127533492
Public Clones IST14490C2 (tigm) IST14326A1 (tigm) IST13772E9 (tigm) IST13789C9 (tigm)
IST12576E6 (tigm) IST13549G7 (tigm) IST14494B3 (tigm) IST13955C7 (tigm)
IST14632G5 (tigm) IST13810G7 (tigm) IST14077H2 (tigm) IST14379G9 (tigm)
IST14288E4 (tigm) IST10218F10 (tigm) IST13580F4 (tigm) IST14183C4 (tigm)
IST13390E4 (tigm) IST14755C10 (tigm) IST13565F11 (tigm) IST13657G6 (tigm)
IST14613G12 (tigm)
Private Clones OST369125 (lexicon) OST175400 (lexicon) OST125689 (lexicon) OST112771 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI951
Vector Insertion
Chr 10: 127533580 - 127545949
Public Clones (sanger) BB0558 (sanger) 5SD010D01 (ggtc) 3SD177D03 (ggtc) 3SD048F08 (ggtc)
3SD152B12 (ggtc) IST14311D7 (tigm) IST14577D11 (tigm) IST14643F9 (tigm)
IST14395G2 (tigm)
Private Clones OST422390 (lexicon) OST283247 (lexicon) OST194013 (lexicon) OST80289 (lexicon)
OST66188 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6072
Vector Insertion
Chr 10: 127546088 - 127547810
Public Clones YHD148 (baygenomics) A057E02 (ggtc) A057B03 (ggtc)
Private Clones OST289544 (lexicon) OST252720 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9459
Vector Insertion
Chr 10: 127548405 - 127549637
Public Clones RRD099 (baygenomics) PST10752-NR (escells) IST13034C4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12656
Vector Insertion
Chr 10: 127550738 - 127551389
Public Clones W098F06 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7067
Vector Insertion
Chr 10: 127552142 - 127553116
Public Clones RRZ103 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15932
Vector Insertion
Chr 10: 127553226 - 127553361
Public Clones not available
Private Clones OST470079 (lexicon)
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI527
Vector Insertion
Chr 10: 127556935 - 127558166
Public Clones CA0116 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 48% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2366
Vector Insertion
Chr 10: 127562702 - 127563073
Public Clones AC0515 (sanger) AD0392 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000045621
Sequence
CTGCGTCACCAGCCGCCGCCCGGCCTCGCCACCCCTC - UNI20228 - AGGATTCTCTCCAACGACCAAGGTCCTGCAGATGACACCAGGAAAGCAG

TGATCCAGGCAGGACCAGGTTGTCCCTACAGGACATAG - UNI951 - AAATGGAGGCAAACGACCATTTTAACTTTACTGGCCTTCCTCCTGCACCA

GCTGCCTCAGGACTGAAACCCTCTCCTTCCTCGGGGGAGGGCCTCTACACTAACGGGTCTCCCATGAACTTCCCCCAGCAAGGGAAAA - UNI6072 -

 GTTTGAATGGGGATGTGAATGTTAATGGCTTATCTACTGTATCTCACACTACTACTTCAGGGATTTTGAACTCTGCTCCCCACTCCTCTAGCACCTCAC

ACCTCCATCACCCTAACGTGGCCTACGACTGTCTTTGGAACTACTCACAGTACCCATCTGCCAATCCTGGCAACAACCTCAAGGACCCACCCCTTCTTTC

TCAGTTCCCTGGGGGACAATACCCGCTCAACGGTATCCTTGGGGGCAACCGACAACCTTCATCCCCAAGTCACAACACTAATCTTCGAGCTGGGAGCCAA

GAGTTCTGGGCCAATGGTACCCAGAGTCCCATGGGGCTTAACTTCGATTCACAGGAACTGTATGATTCTTTTCCTGATCAGAATTTTGAGGTGATGCCCA

ATGGACCCCCAAGTTTTTTCACCTCCCCTCAGACTTCTCCAATGTTGGGGTCTAGTATCCAGACCTTTGCACCTTCCCAGGATGTAAGCAGTGACATCCA

TCCTGATGAAGCAGCAGAAAAGGAGCTGACTTCAGTTGTGGCAGAAAATGGCACTGGCTTGGTAGGCAGCCTGGAGCTGGAGGAAGAGCAGCCAG - UN

I9459 - AACTAAAGATGTGTGGCTACAATGGTTCTGTCTCCTCTGTGGAGTCTTTACACCAAGAAGTCTCCGTCCTGGTCCCTGATCCCACAGTGAGC

TGTCTAGATGATCCTTCACATCTTCCTGATCAACTGGAAGACACTCCAATTCTCAGTGAAGACTCCCTGGAGCCCTTTGACTCTCTGGCAGCAG AGCCA

GTGAGTGGCAGTCTTTATGGTATAGATGATGCGGAGCTGATGGGTGCAGAAGACAAGTTGCCTCTGGAGGGCAACCCTGTGATCTCTGCCCTCGATTGCC

CTGCTCTCAGTAATGCTAATGCCTTCAGTCTCCTGGCAGACGACAGCCAGACATCAGCCTCCATCTTTGTCAGCCCTACCTCCCCACCTGTCTTAGGGGA

GTCTGTCTTGCAAG - UNI12656 - ATAACAGCTTTGGACTGAACAGTTGCAGTGACTCTGAACAGGAAGAAATAGAGACCCAGTCTTCAAACTTCC

AACGTCCCCTGACTGAGCCAGCTCCTGACCAGCCACCTAGTACTCAACTACATCCAGCAGTTTCACCAACAGCCTCCCCAGCAGCCTCCTTGACAGCATC

TGCAGAAATCTCTCCAGCTGTCTCTCCAGTAGCATCCTCGCCTGTCCCTCCTGAAGTCTTTGTAGCAGTCTCTCCAGCTTCCTCACCTGCTCTGCCAGCC

ATCTCTTTGGAAGCCTCTATGACAACTCCAGTAACTTCTCCTCAAGGTTCCCCTGAACCTTCTCCAGCAGCTGCCTTCCAGACTGTCTCCCCAGCAAGGA

AAAATGTCAGCAGTGCTCCTAAAGCGCGTGCTGATCGAGAAGAGACGACTGGAGGAGCAGTTGCAGTCTCTGGTAGTG GTGATGTACTGAAGAGACGTA

TTGCTACCCCAGAAGAAGTTCGTCTTCCCCTCCAGCATGG - UNI7067 - GTGGCGAAGAGAAGTGCGCATCAAGAAGGGCAGCCATCGGTGGCAGG

GGGAGACTTGGTACTATGGCCCCTGTGGGAAGAGAATGAAGCAATTTCCAGAAGTTATCAAG - UNI15932 - TACCTGAGCCGAAATGTGGTGCAC

AGTGTCCGCCGTGAGCACTTCAGCTTCAGTCCCCGCATGCCTGTTGGAGATTTCTTTGAAGAAAGAGATACACCAGAG GGCTTGCAGTGGGTCCAGTTA

TCAGCAGAGGAGATTCCTTCCAGAATTCAAGCAATCACTGGCAAACGAGGCCGACCTCGAAACAATGAGAAGGCTAAGAACAAGGAAGTTCCCAAAGTGA

AGCGGGGCCGAGGTCGGCCTCCTAAGATCAAAATGCCTGAGCTGTTGAATAAAACAGATAACCGACTTCCAAAGAAACTGGAAACCCAAG AAATACTGA

GTGAGGACGATAAAGCAAAGATGACTAAAAACAAAAAGAAGATGAGGCAGAAGGTCCAACGGGGAGAAAGTCAGACTCCTGTCCAAGGGCAG GCCAGAA

ACAAGAGGAAGCAAGACACCAAGAGCTTGAAGCAGAAGGACACTAAGAAGAAATTGAAG GCTGAGAAAGAGAAGATGAAGACAAAGCAGGAAAAGCTGA

AGGAAAAGGTAAAGCGAGAAAAGAAAGAAAAGGTAAAAGCGAAGGGGAAGGAAGGGCCCAGAGCCAGGCCATCCTGTAGAGCAGACAAGACCCTTGCCAC

ACAGAAGCGGCTAGAGGAGCAGCAGAGGCAGCAGGCTATCCTGGAGGAGATGAAGAAGCCCACAGAGGATATGTGTCTGTCTGACCACCAG CCCCTGCC

TGACTTCACACGCATCCCTGGTTTGACACTGTCCAGTAGGGCTTTCTCAGATTGCTTGACCATCGTGGAGTTCCTTCACAGTTTTGGCAAAGTGCTAGGC

TTTGACCTTACCAAAGATGTTCCTAGTCTAGGAGTCCTGCAGGAGGGACTCTTATGTCAAGGTGACAGCTTGGACAAAGTGCAGGACCTGCTGGTGCGAC

TGCTGAAGGCTGCACTCCATGATCCTGGTCTGCCCCCCTACTGTCAG - UNI527 - TCCCTGAAGATATTGGGGGAGAAGATGTCAGAGATCCCATT

GACCAGAGATAATGTGTCTGAGATACTGCGCTGCTTCCTCATGGCATATAGAGTGGAGCCATCCTTCTGTGACAGTCTGCGTACCCAGCCTTTTCAGGCC

CAGCCACCTCAACAGAAGGCTGCTATTCTAGCCTTCCTTGTGCATGAGCTTAACAGCTCCACCATTATCATCAA TGAGATTGACAAGACTCTGGAAAGT

GTGTCTAGCTGCAGGAAGAACAAGTGGATTGTTGAAGGCCGACTCCGGAG ACTGAAAACTGCTCTGGCCAAGCGAACTGGGCGGCCTGAGGTTATGATG

GAAGGGGCAGAAGACGGCCTAGGACGGAGGCGCAGTTCTCGGATCATGGAGGAAACCAGTGGCATAGAAGAGGAGGAAGAGGAAGAAAATACAACAGCTG

TCCATGGCCGCAGGGGTCGAAAAGAAGGAGAG ATTGATGTTGCAGCATCTAGCATTCCAGAGCTAGAGCGCCATATAGAAAAACTCAGTAAG CGTCAG

CTCTTCTTTAGAAAAAAGCTGCTTCACTCATCCCAGATGCTTCGGGCAGTGTCCTTGGGTCAAGACCGCTATAGACGCCATTACTGGGTATTACCGTATC

TTGCTGGTATCTTTGTGGAAGGATCGGAAGGGAGCACAG TTACTGAAGATGAAATAAAGCAAGAAACTGAGTCCTTGATGGAAGTAGTCACTTCAACAC

CCAGCTCTGCCCGAGCCTCTGTAAAGAGAGAATTAACTGGCTCCAATGCCTCTACTTCTCCTGCCCGGTCCCGAGGCCGACCTCGAAAACCTAAGCCTGG

GTCTCTGCAGCCTCAGCACCTTCAGTCCACCATTAGGGAATGTGATTCAGAGCAAGCCCAGACTCAAGTTCACCCAGAACCCCAGCCTCAGCTTCAGGCC

CCTACCCAGCCCCATCTTCAGCCAAGTAGTGGGTTCCTAGAGCCAGAAGGTTCCCCTTTCTCTCTGGGTCAGAGCCAGCATGACCTCAGCCAGTCTGCCT

TCTTGTCTTGGCTGAGCCAGACTCAGAGCCACAACTCCCTGTTGAGCAGCTCAGTCCTCACGCCGGACAGCAGCCCAGGGAAACTAGACTCTGCTCCGTC

TCAGTCCTTGGAGGAGCCCGAGCCTGATGAGGCTCAGTCCTGCCCTGGTCCTCAAGGTCCCTGGTTTAACTTCTCAGCCCAGATACCCTGTGATGCTGCT

CCTACACCACCTCCTGCAGTCTCTGAGGACCAACCTACTCCCTCCCTCCAGCTGCTGGCCTCCTCTAAACCA ATGAATACACCCGGTGCTGCCAATCCT

TGTTCCCCAGTGCAGCTCTCTTCCACTCACTTGCCTGGAGGGACCCCTAAGAGGCTATCAGGGGACTCTGAAGAAATGTCACAGAGTCCCACTGGGCTGG

GGCAACCAAAGCGGAGGGGGAGACCCCCTAGCAAGTTCTTCAAGCAGGTGGAGCAGCATTACTTAACCCAGCTGACAGCCCAGCCTATCCCCCCTG AGA

TGTGCTCGGGCTGGTGGTGGATCCGAGACCCTGAGACACTGGATGTCCTGCTCAAGGCACTGCATCCCCGAGGCATCCGGGAGAAGGCGCTTCACAAACA

TCTTAGCAAGCACAAGGACTTTTTGCAGGAAGTTTGTTTACAGCCCTTAACTG ATCCCATCTTTGAGCCTAATGAGCTCCCTGCCTTGGAAGAAGGCGT

TATGAGCTGGTCCCCCAAAGAGAAGACGTACGAGACAGACCTAGCTGTGCTCCAGTGGGTGGAGGAGCTGGAGCAGCGGGTTGTCCTCTCCGATCTGCAG

ATTCGG GGCTGGACATGCCCTACCCCAGACTCCACCAGAGAAGACTTGACCTACTGTGAGCATCTGCCTGACTCCCCGGAGGATATCCCTTGGAGGGGT

CGGGGCAGGGAAGGAACAGTACCTCAGCGGCAGAACAACAACCCTCTGGACCTCGCTGTGATGCGATTGGCTGTTCTGGAGCAAAATGTGGAGCGGCGGT

ACTTGCGGGAGCCCCTCTGGGCAGCCCATGAGGTGGTAGTGGAGAAGGCCCTACTGAGCACACCCAATGGTGCCCCTGATGGCACCTCAACTGAGAT AT

CCTATGAGATCACCCCTCGTGTCCGAGTTTGGCGGCAGACACTTGAAAGGTGCCGTAGTGCAGCCCAAGTGTGCTTGTGCATGGGCCAGCTAGAAAGGTC

CATCGCGTGGGAGAAGTCTGTCAACAAAGTG ACCTGCCTGGTCTGCCGGAAGGGCGATAATGATGAGTTTCTCCTGCTGTGTGATGGGTGTGACCGAGG

CTGCCACATTTACTGTCATCGGCCCAAGATGGAGGCTGTTCCAGAAGGAGATTGGTTCTGTGCTGTCTGTCTGTCCCAG - UNI2366 - CAGGTAGA

GGAAGAGTACACTCAGAGGCCTGGTTTTCCAAAACGAGGTCAGAAGCGGAAAAGTAGTTTTCCACTGACCTTCCCAGAAGGTGACAGCCGGCGGCGGATG

TTGTCAAGGAGCCGAGATAGTCCAGCAGTGCCTCGGTACCCAGAAGACGGGCTGTCTCCCCCCAAAAGACGGCGACATTCGATGAGAAGTCACCACAGTG

ATCTCACATTTTGCGA GATTATCCTGATGGAGATGGAGTCCCATGATGCAGCCTGGCCTTTCCTAGAGCCTGTGAACCCTCGCTTGGTGAGTGGATACC

GACGTGTCATCAAGAACCCTATGGATTTTTCCACCATGCGAGAACGCCTGCTCCGTGGAGG GTACACTAGCTCAGAAGAGTTTGCAGCTGATGCTCTGC

TGGTTTTTGACAACTGCCAGACCTTCAATGAGGATGACTCTGAAGTGGGCAAGGCTGGGCACGTCATGCGACGCTTCTTTGAGAGCCGCTGGGAGGAATT

TTATCAGGGAAAACAGGCCAATCTGTGAGGCAAGGAAGTTGGGAGTCACTTTGTGGCATCTTCTCCAACCTTCCAAACAAAAACCTGCCGTTCTCACCTG

CTGATGGCTGCCCTGGGTGGACTCAAGTCAGACAATGCTGACTCTTGACTCTGCCCTTGGCAGCACCCACATCCTCTTGTTCCGAATCCCTTTTCTCCCT

TCCTCCTCTGGCTCCTCAAATAAGAGATGCAGAGATGAGGTCCTTCTGGATGGAAAGCCAAAAAAGAAAAAATTTTCCTGTCTCTCCTCCTCCTCCCCCC

CCCCCCCATTAAAATGGAGAGAGACAAAGAAGTCCTCCTTCCCCTTCCCAGCTTCCTCCCCTCCCTGTCCATGCCTCAGCATCCTGGGGCTATTTAACAA

TAGCAATAGTTCTAGTGAATGTGTGAAACTGAGAAACACTCTGTACTGTGTGCGGACCCGCAGTGACGGCCAGTAAAGTGGACTTAACTCCCAAGTGTGT

CGAGCCGGACACCGGGCCCTGAACATGCTGCTTCCATGTTCAGTCCCCTCCCTGCTTCTCACTTCCTCTCACTCATTCTGTTCTAACTCCTCCCTATTTT

TAAGGTTTTGTCTCACCCAGTAATGTAAAACTATCGTGTACGGGTTCTTTACCTTCCCTCCCAGTCTTTTTCCCTTATGTGGAAAACAAAGTTGAGAGCT

CTCCTGTCTTTCTGTCCTCATCTTCTGCCTCCCTTCTAGTTAACCCTCTAAGGTGTTGGCTCCTCCTCACATGCTGAGTTTCTGTGAGTCTCTAGCCTTT

TCTGAAGCTCGGTGGCTGGGGAGCGGACAGGCAGGCAGTGCCCTAGGCCTTCCAGCCTCCTTCCCCTGCTTCCCAAACCTCCCTCTTGGGAACTCCTCAG

GGACAACTACTGCTGAGTTTGAGTGCTCCTCCGAGATGGGGGCCAGGTAGCAATTGACTGGCCTCAGAGAGAGGAGGAGAGAGAGGTGGGTGTGGGTGTG

TGTTTTGTGTCTGTGTGTGTGCACGTGCACAGATGAGAGTTGTGATTGTGACCCTGTAGTGTGATGGGACTCATTGTTCCCCACATGTGTTTATTCCCGC

CTTCCCATTGTTTCACACCATCAACCTTTTGTCTTTGGGAAAACACAAGAACAAGGGTTCTCTGGGGACAAGGCTGTCTCTCCTCATGGTCATTTCTTTT

CCAGCCTCTTCAAACTGTGCAATCTTTTCAGCAGGAACTCCCTCTCCCTTCACTAGCTTTGAGTTTTTGCTGGTAGGGGGGTAGAACTGGATCTTTCCTA

AACCATGAGTGTCTGGGTTTAGCTGTGTTTTCCTTCCTTACACCGACTTCATGTCCCAGGACCCCTTTCTTCCCCAGCAGCAGAGACCCTGGAGCACAGA

ATGGGCAGAGAGGAGGATTTGGGTCTACCACTGCCCTGTGTGTGACTGAGCCCAGGTTAGCCCCCAGCATGAGAGGACAGCTGCTAACTCCAAGCTGTAG

CCATGGGCCACTGGCCCCTGCTTTCCTGCTCAGCCAAGCCCCTCCCATCAGAAATTACGGGTACTTGCACTGGGGAGGTGGCTGCTAGCTGACCTAAGCA

GGGAGCCAAGGCATCCAAGCAATGTTCCATGGGTGGGCGGAGGATGCCAGGTGAGGTGTAGCATTCCTTGTACTCCAGCAGTACTAAAGAGTGGGGCAGT

GCGGGTTCCTGGGCAGCCCTGACTCCTCGACCCACCCTCACCGCACTCCCGGTTGCCTGTTTCTAAAGTCGCCTTTTCTGTCGATGAACCTCAAAACTTA

ATTTTATTTGAGAATTTTTTTTCTTTTAAATAAGAGGTGGATTGAAGAATATTTGAATTGACTTTATATTATGCATAAATATTTATATTTTATCTAAATA

ACTGCGCTGTAACAAACTTTGTGTTAGTCAGATGTTTGGAACTGTTTCCCCTGGCATAAAGTGTACTGGAGTCATTCGCTACTGGAGGTGCGGGAGGAGG

GAGAGTGGAGCCTCTGCTCTGCTCTGTGCTCCTCTCCCAGCCCCACCTCTGCCCTCGGGACCAGGCACTCAGAAGGAGGAGGTCCCAGACTTGATTGTAG

AAATGGGGACTGAAGGGATTGTGGGCAGGATGTGATCAAAGGGGCCATTTCTCACTTTTCTTTCCTCATCCTCACTGCCCCTCAAGCTAGGTGGATTTTT

CTCTTGTTGACAAAGAGTATTTGGTAGGGAAAGCAGGTTAAAAATAAAGACAGCCCTTCCCTGCCCTTTGTGTCCCCTTCCTGGTGACAGCAAGAAACCA

TCAACACCAACAAGTTTCCACGTTCCTTTTACAGCAAAAGGGACTTTTTATATAACCAAATGTGGTGTCTTAGTGACTTTTTGATAATGTACAGTTTTTT

GTGAATTTAAATTTATTTCTTTCTATATTTTTAGGACCAATCTCATTTTTAATAAGGTTTAAAAAAAGGAAAAAAAGTCTAGAGAAAAAAAAATACCTTG

TTTTTGCCATGTGATGTTCCACAGGTGCGGCTGTAGAAAAGTGCTTGTCATTGAATAAAAACCACATTTGATAAAAGA
Translation
 - UNI20228 -  - UNI951 - MEANDHFNFTGLPPAPAASGLKPSPSSGEGLYTNGSPMNFPQQGKS - UNI6072 - SLNGDVNVNGLSTVS

HTTTSGILNSAPHSSSTSHLHHPNVAYDCLWNYSQYPSANPGNNLKDPPLLSQFPGGQYPLNGILGGNRQPSSPSHNTNLRAGSQEFWANGTQSPMGLNF

DSQELYDSFPDQNFEVMPNGPPSFFTSPQTSPMLGSSIQTFAPSQDVSSDIHPDEAAEKELTSVVAENGTGLVGSLELEEEQPE - UNI9459 - ELK

MCGYNGSVSSVESLHQEVSVLVPDPTVSCLDDPSHLPDQLEDTPILSEDSLEPFDSLAAE EPVSGSLYGIDDAELMGAEDKLPLEGNPVISALDCPALS

NANAFSLLADDSQTSASIFVSPTSPPVLGESVLQD - UNI12656 - DNSFGLNSCSDSEQEEIETQSSNFQRPLTEPAPDQPPSTQLHPAVSPTASP

AASLTASAEISPAVSPVASSPVPPEVFVAVSPASSPALPAISLEASMTTPVTSPQGSPEPSPAAAFQTVSPARKNVSSAPKARADREETTGGAVAVSGSG

 GDVLKRRIATPEEVRLPLQHG - UNI7067 - GWRREVRIKKGSHRWQGETWYYGPCGKRMKQFPEVIK - UNI15932 - YLSRNVVHSVRREH

FSFSPRMPVGDFFEERDTPE GLQWVQLSAEEIPSRIQAITGKRGRPRNNEKAKNKEVPKVKRGRGRPPKIKMPELLNKTDNRLPKKLETQE EILSEDD

KAKMTKNKKKMRQKVQRGESQTPVQGQ ARNKRKQDTKSLKQKDTKKKLK AEKEKMKTKQEKLKEKVKREKKEKVKAKGKEGPRARPSCRADKTLATQK

RLEEQQRQQAILEEMKKPTEDMCLSDHQ PLPDFTRIPGLTLSSRAFSDCLTIVEFLHSFGKVLGFDLTKDVPSLGVLQEGLLCQGDSLDKVQDLLVRLL

KAALHDPGLPPYCQ - UNI527 - SLKILGEKMSEIPLTRDNVSEILRCFLMAYRVEPSFCDSLRTQPFQAQPPQQKAAILAFLVHELNSSTIIIN N

EIDKTLESVSSCRKNKWIVEGRLRR RLKTALAKRTGRPEVMMEGAEDGLGRRRSSRIMEETSGIEEEEEEENTTAVHGRRGRKEGE IDVAASSIPELE

RHIEKLSK RQLFFRKKLLHSSQMLRAVSLGQDRYRRHYWVLPYLAGIFVEGSEGSTV VTEDEIKQETESLMEVVTSTPSSARASVKRELTGSNASTSP

ARSRGRPRKPKPGSLQPQHLQSTIRECDSEQAQTQVHPEPQPQLQAPTQPHLQPSSGFLEPEGSPFSLGQSQHDLSQSAFLSWLSQTQSHNSLLSSSVLT

PDSSPGKLDSAPSQSLEEPEPDEAQSCPGPQGPWFNFSAQIPCDAAPTPPPAVSEDQPTPSLQLLASSKP MNTPGAANPCSPVQLSSTHLPGGTPKRLS

GDSEEMSQSPTGLGQPKRRGRPPSKFFKQVEQHYLTQLTAQPIPPE EMCSGWWWIRDPETLDVLLKALHPRGIREKALHKHLSKHKDFLQEVCLQPLTD

 DPIFEPNELPALEEGVMSWSPKEKTYETDLAVLQWVEELEQRVVLSDLQIR GWTCPTPDSTREDLTYCEHLPDSPEDIPWRGRGREGTVPQRQNNNPL

DLAVMRLAVLEQNVERRYLREPLWAAHEVVVEKALLSTPNGAPDGTSTEI ISYEITPRVRVWRQTLERCRSAAQVCLCMGQLERSIAWEKSVNKV TCL

VCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCAVCLSQ - UNI2366 - QVEEEYTQRPGFPKRGQKRKSSFPLTFPEGDSRRRMLSRSR

DSPAVPRYPEDGLSPPKRRRHSMRSHHSDLTFCE EIILMEMESHDAAWPFLEPVNPRLVSGYRRVIKNPMDFSTMRERLLRGG GYTSSEEFAADALLV

FDNCQTFNEDDSEVGKAGHVMRRFFESRWEEFYQGKQANL

For any suggestions or comments, please send an email to unitrap@crg.es