Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040093 (Bmf)
Chromosomal location
Chr 2: 118354496 - 118375398 (-)
Description
BCL2 modifying factor Gene [Source:MGI (curated);Acc:Bmf-001]
RefSeq_dna
NM_138313 
RefSeq_peptide
NP_612186.2 
UniGene
Mm.210125 
MGI
MGI:2176433 
Uniprot/SWISSPROT
Q91ZE9 
Uniprot/SPTREMBL
A2AV75 Q3TAQ6 A2AV74 
Human Ortholog
ENSG00000104081 (BMF)
Omim not available
UniTrap UNI20983
Vector Insertion
Chr 2: 118372749 - 118373106
Public Clones not available
Private Clones OST346655 (lexicon) OST170228 (lexicon) OST60836 (lexicon)
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16696
Vector Insertion
Chr 2: 118358396 - 118370817
Public Clones CMHD-GT_493F8-3 (cmhd)
Private Clones OST455802 (lexicon) OST379760 (lexicon) OST379351 (lexicon) OST358516 (lexicon)
OST276543 (lexicon) OST74487 (lexicon)
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000090219
Sequence
ATGCCCGGAGCGGGCGTATTTTGGAAACAATACCGCGCGGTGTGCCGTGGCCTCCTCCCGCGCCAGCTCGCGCCTGCAGCAGTCGCTGCCGCAGCCCGCG

CCACCGCCTCCCACCGCAGCCCG CTGGAGTTTGCCCCCTTCTTCCCAATCGAGTGTGGGCACCAAGCCCCCCGAGTGTTCTTCACCCTGGACCCTGGCG

CAGAGCCCTGGCATCACAACTCGGAGGCTGAGACGCTGTCCTGGAGTCACCCAG - UNI20983 - GAGAGATGGAGCCACCTCAGTGTGTGGAGGAG

CTAGAAGATGATGTGTTCCAGTCAGAGGATGGGGAGCCAGGGACACAGCCTGGGGGCTTGCTCTCTGCTGACCTGTTTGCCCAGAGCCAGCTGGACTGTC

CCCTCAGTCGACTCCAGCTCTTCCCTCTCACCCATTGCTGTGGTCCCGGACTCCGGCCCATAAGCCAGGAAGACAAGGCCACTCAGACCCTCAGTCCAGC

TTCCCCAAGCCAGGGTGTCATGCTGCCTTGTGGGGTGACAGAGGAACCCCAGAGACTCTTTTACG GCAACGCTGGCTACAGGCTTCCTCTCCCTGCCAG

TTTCCCTGCAGGCTCACCCCTTGGGGAGCAGCCCCCTGAAGGACAGTTCCTTCAGCACCGAGCAGAGGTGCAGATCGCCAGAAAGCTTCAGTGTATTGCA

GACCAGTTCCATCGGCTTCATACGCAACAA - UNI16696 - CACCAGCAGAACCGAGACCGTGCGTGGTGGCAGGTCTTCCTTTTCCTTCAAAACCT

CGCCCTGAACAGACAAGAAAACAGGGAAGGGGTGGGGCCCTGGTGAGGCTGGACCGCCCTGGCCGGATGGATCACCAGGAATGCAGTCTGGGAGGACAGA

TACTGTCTTGTTAAGTTTTGTTATCCGTAACTTTCTATCCATGTGTACATATTACATGCCCCAGTGGGATCTTCTTTCCCCGTTCAGAACCTCCACTGAG

GATGGGGGCCTTTGTCAAACACTGTTGAAGGAGAGGCAGCTGTGTCTGCTGGTAGAGTTCCTAAGGCTCTGAAGATGACCAGTTGGTGATGTTCTCCAGG

AAGTGGACTGAGACTTGCTACCGGAGCTGGTTAAGTCAGGTTAGGCTCCCAGTACCATCAAACATGTCAGCCTTCCTTCGTGCCTGATGGATCATGGCTT

TAACCCACCAGGACCCTGTCTGGGAGCCTCCTGGCTAAGATCAACTGTGCCTTGGCTAGCCCGATTCACGTCTGGGTTCCCACTTGGCACAGCCAGCGCC

CACCGCATGGGCTCAGGGATTCTTACTCAGACGCTGTCAACTTCCGGAAGACCTCAGGGAGGGTCGGACTTCTCCAAGAACCCCTCAAAGGTGCCACAAA

ATGAATCAAACTTGAGAGGCTTCAAGTCTGACTCGGTCCTACATGGAAGCCCCTTGATTGGTCCCCAAGGGTGCAAACTACTGCCACCTTTGCTGGAGCC

AAGTAGCCAGTCACCATGCCGTTGTACCCAGCGGCCTGTGCCTTTGTCAGCTCTGTTTTCAGAAGACCCTGCCAATGACTGGACTGGATCTGTCTGCATC

CATCTCAGCAGAAGCACTTGGAGATGGGGTGGGCTTGCTGGGGGCGTGGGAACCCAGCAGCCATCCCACTGATAAGTTGGTCCCGGGGGAATCCTAGACC

TCTTGGTTTCCTTGGAAACGTGTACCTCCTCCCCCTTACCCCCATTCCTTTTCTGTACCTAGCGGGATACAGGAAGAAGCTAGGACTGAGGCTTTGTCAG

CTGAAAAGTGACTTTGGAAGTAACAGACAATGTTTAGACCATGGAAACTGCAGAGCTGACACATCTTGAATCTCCCTTTAGCTTTCAGCTAGGCCAGAAA

GGAGAGTTCTAGAACCCAGCAGGACCTTAGCTGCCTGGGAGCTCCTTCCTTCTCTCCCCGCTGCAGTGCTCAGGGAGGGAACGAAAAGCAGCTGATCTTA

GAAATTAAGTCCTAAGTGTTATGTATGTAAGGAAAGACATTGGTGCTATAATGAAGATGAGCCAAGGCTCAAAGAAAGATGGCTTCCCTAGACAAAGAAG

AACACAGGATTATTCAAGGACTTTGGAGGAGAAACTCAGAGTAGACTCAAATTGAACAAGCCCAGTGACTCCCCATTCTGCAGAAGTGGGGGGGGGGGGC

GGATTTCAGTACCATAAAAGGGCACCGGATCTCCTGGGTGTCCAGTTGGGCAGGTTTCTCCCTGCCAAGGCTACCGACAGAGGGGGCTCATAGAGGCTGA

GGTCCAGCCTGTGCCCTGCTCTCTAGGCTGCACATCCTGATGTGGGCAGGGTCTGCCCAGAGTAAGGAATGTCTTTCCTAATTTGCACAAAGGTACTGTG

TGCACTCTCAGTGGTCCTGAGGAGGACCTTAAGGCATGTGTATAAGCCTTTGTGTTTTTCTGCTCAGATGACCTGGAGATATTACCTCTTCTTGGCCACA

ATCATTTTTCTCAGGGTCTATACCATAGTTCGTCTGCTAAGAAAGTGGGTTTCTGTTTGCAAGGAGAGGGGACCCAAGTAATGAATATGAAGACTGGTTC

TGAGGGTGGGCTTGATTATTTGTGAAGCCCAGCCTTCCTACATCCCACCCTCCCTGCAGTTTAGATGTGTGTGGGACATATGTGGTCTTCCCCTTTCCTG

GATCAAGGCTATGACAGGCAGGCTTCTGGTATGTGCTTGGTACATGTGCTGCAATACATGTGCTTGATGGTACATGCGTGCCCCTCCCCATACAGAACCT

TGTACTTCAGTTATCTTTAACATAACTTAGTAGACTTTCCATCTGTCCTAAGGCATGACTGTCAGCTTCAGCAACCTTGCTAGGTGCAGGCTGGGTACCC

TGTGGCCTGAGAACTGAGCCCAGAGTTTGACCTGAACATTGAGCCTGGACCAGGCAGAAGCTGGTCAGAATGTACTGTCTCCATTTTGGGCCAAGCCGGG

ACCAAACTTACTAACTCAGGCAAGCCAGGGTGAAACTTAAACCCTCTTTTATCTTTAACCTGAATCCAGGCTGGAGTTGAAGCTCAATGATAAAGGGCTT

GCCTGTCGGTCAAGAGACCCTCGGATGGATCCCAGGACTGTAAAATATAAATAAATAAAAATATGCCCCCTCTCTCCAACCTCTTGGAGGCAGCTGGCAG

CCCAGCTCAAGGAGGCAAGAGGTTCCCCCTGGCTGCTTGCTTTAATTGGCCGGTGATCTCTGCCTGGTGAATTGGTTTTATAGTCTCTGAGTCCAGCCCC

TGGACAACCCCTCCCCTTTGCCTCTCCAGAACTCCAGGAGCTTGGCTGTCTCTAGTGAAGAGTGGAGATTCAGATTCTGAGGGAGGGAGGGAGGGTCTGA

CCTGTGTGGTGACCTGTAACCAGCTGAAGGCAACAGGCTTTTGTGGTGTGCTGAGGATGGGGGGTGGGAGAAGAGCTGGAAAACTCTGTAGAAATGCCCT

AGAGGAACAGAAGCCCTGTATTCAGGGGCCAAACTGCTCTACTAATTCACAATCCCCAGGAGGCATTTCTAAAAGCCAGTGAACAGATCTGGAGAGGAAC

ATCCCCCAGTCCCGTCACTGACTCCCCCAGGGAGACTGGGGTGGTACGCAGGAGAGTGGGGGGAGGGTGGGCACTTTGCCTGGCCCTGTCTCTCTGTTTC

AAAGTTTGGCTGTGCTGTTCAGTTGTCCCCAGTGGCCTTGTCTTGCTCAATCAGAGGTGGAAAAAGATCACCTCCCGGTGACCTCCTTCAGGCCCCAGGG

GATGGGCTGTGTCCAGAGCTATGTGGCAGAGCTTGTTTCCAGAGCCCAGAGAGGCCCCGCTGGCCTGCCTTGCTGCCCCAGTGGCGAAACGCAAGCCCAA

CACTGAGCATGGCAGGGAGTGGGTGTTGGGGACAGTCTAGCCAAGGCCCCTGTCTGTCCCAAGCTTTCCAGGAACTAAGCAGTGAGGTCACTGTGACAGT

CCTGCCTGGTCAGCGAGGAGAATATTCTGAGCTTTCCCGCTCTGGGACTTACTGGGGAGGGGGCGGGTACCAGTGTATGGAGTAACAAGACATCAGCCTT

CGTGGCTCTGCAGGATTTGGGGGAATCAGTACAGTGGCCACTGTGGCTGCTATGAAGATAAGGCCTTTTGGAGACAGGCTATCCTGGCCTGATACCCTGG

TTGGACCTAGAGGGATACAGGGTGGAGCCACAGTCATTTCAAGTTCCCTGGGGTTCCTGTGGGCTGCAGACCTAGGGGACAGAGCCTCAAGGAAGACAGC

AGAACAAAGCTGAGCTCTTCCATATATGCCAGCTTTGGCCAAGGTGCTATGAGGTCTGTGACCCCAGGCTTGCACTGCCCCTTTCTCTACAGTTGTCTGA

TGTCCACCCCATCTCTGGGTTCACAGAAACTGACACGGGGAGACCCAGCGAGATGTAGCATTTCCTTCATCCCCAGTCTGGTTGGCCCGGGGTCTGGGCA

TCCTGCCTTAAGGAAAGGAATGGGGACCATTATTTTTTAACCTGTATATAATATTTGACCTTTTTTTGGTTCTTTATATGTATACATGTGTAAATATCCT

CTCATCCATCAAGTGGTACAGTTTTTAATAAAACCATTTAAAGC
Translation
MPGAGVFWKQYRAVCRGLLPRQLAPAAVAAAARATASHRSP LEFAPFFPIECGHQAPRVFFTLDPGAEPWHHNSEAETLSWSHPG - UNI20983 - 

GEMEPPQCVEELEDDVFQSEDGEPGTQPGGLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG

 GNAGYRLPLPASFPAGSPLGEQPPEGQFLQHRAEVQIARKLQCIADQFHRLHTQQ - UNI16696 - HQQNRDRAWWQVFLFLQNLALNRQENREGV

GPW
Transcript ENSMUST00000110859
Sequence
ATGTCCCCAG - UNI20983 - GAGAGATGGAGCCACCTCAGTGTGTGGAGGAGCTAGAAGATGATGTGTTCCAGTCAGAGGATGGGGAGCCAGGGAC

ACAGCCTGGGGGCTTGCTCTCTGCTGACCTGTTTGCCCAGAGCCAGCTGGACTGTCCCCTCAGTCGACTCCAGCTCTTCCCTCTCACCCATTGCTGTGGT

CCCGGACTCCGGCCCATAAGCCAGGAAGACAAGGCCACTCAGACCCTCAGTCCAGCTTCCCCAAGCCAGGGTGTCATGCTGCCTTGTGGGGTGACAGAGG

AACCCCAGAGACTCTTTTACG GCAACGCTGGCTACAGGCTTCCTCTCCCTGCCAGTTTCCCTGCAGGCTCACCCCTTGGGGAGCAGCCCCCTGAAGGAC

AGTTCCTTCAGCACCGAGCAGAGGTGCAGATCGCCAGAAAGCTTCAGTGTATTGCAGACCAGTTCCATCGGCTTCATACGCAACAA - UNI16696 - 

CACCAGCAGAACCGAGACCGTGCGTGGTGGCAGGTCTTCCTTTTCCTTCAAAACCTCGCCCTGAACAGACAAGAAAACAGGGAAGGGGTGGGGCCCTGGT

GAGGCTGGACCGCCCTGGCCGGATGGATCACCAGGAATGCAGTCTGGGAGGACAGATACTGTCTTGTTAAGTTTTGTTATCCGTAACTTTCTATCCATGT

GTACATATTACATGCCCCAGTGGGATCTTCTTTCCCCGTTCAGAACCTCCACTGAGGATGGGGGCCTTTGTCAAACACTGTTGAAGGAGAGGCAGCTGTG

TCTGCTGGTAGAGTTCCTAAGGCTCTGAAGATGACCAGTTGGTGATGTTCTCCAGGAAGTGGACTGAGACTTGCTACCGGAGCTGGTTAAGTCAGGTTAG

GCTCCCAGTACCATCAAACATGTCAGCCTTCCTTCGTGCCTGATGGATCATGGCTTTAACCCACCAGGACCCTGTCTGGGAGCCTCCTGGCTAAGATCAA

CTGTGCCTTGGCTAGCCCGATTCACGTCTGGGTTCCCACTTGGCACAGCCAGCGCCCACCGCATGGGCTCAGGGATTCTTACTCAGACGCTGTCAACTTC

CGGAAGACCTCAGGGAGGGTCGGACTTCTCCAAGAACCCCTCAAAGGTGCCACAAAATGAATCAAACTTGAGAGGCTTCAAGTCTGACTCGGTCCTACAT

GGAAGCCCCTTGATTGGTCCCCAAGGGTGCAAACTACTGCCACCTTTGCTGGAGCCAAGTAGCCAGTCACCATGCCGTTGTACCCAGCGGCCTGTGCCTT

TGTCAGCTCTGTTTTCAGAAGACCCTGCCAATGACTGGACTGGATCTGTCTGCATCCATCTCAGCAGAAGCACTTGGAGATGGGGTGGGCTTGCTGGGGG

CGTGGGAACCCAGCAGCCATCCCACTGATAAGTTGGTCCCGGGGGAATCCTAGACCTCTTGGTTTCCTTGGAAACGTGTACCTCCTCCCCCTTACCCCCA

TTCCTTTTCTGTACCTAGCGGGATACAGGAAGAAGCTAGGACTGAGGCTTTGTCAGCTGAAAAGTGACTTTGGAAGTAACAGACAATGTTTAGACCATGG

AAACTGCAGAGCTGACACATCTTGAATCTCCCTTTAGCTTTCAGCTAGGCCAGAAAGGAGAGTTCTAGAACCCAGCAGGACCTTAGCTGCCTGGGAGCTC

CTTCCTTCTCTCCCCGCTGCAGTGCTCAGGGAGGGAACGAAAAGCAGCTGATCTTAGAAATTAAGTCCTAAGTGTTATGTATGTAAGGAAAGACATTGGT

GCTATAATGAAGATGAGCCAAGGCTCAAAGAAAGATGGCTTCCCTAGACAAAGAAGAACACAGGATTATTCAAGGACTTTGGAGGAGAAACTCAGAGTAG

ACTCAAATTGAACAAGCCCAGTGACTCCCCATTCTGCAGAAGTGGGGGGGGGGGGCGGATTTCAGTACCATAAAAGGGCACCGGATCTCCTGGGTGTCCA

GTTGGGCAGGTTTCTCCCTGCCAAGGCTACCGACAGAGGGGGCTCATAGAGGCTGAGGTCCAGCCTGTGCCCTGCTCTCTAGGCTGCACATCCTGATGTG

GGCAGGGTCTGCCCAGAGTAAGGAATGTCTTTCCTAATTTGCACAAAGGTACTGTGTGCACTCTCAGTGGTCCTGAGGAGGACCTTAAGGCATGTGTATA

AGCCTTTGTGTTTTTCTGCTCAGATGACCTGGAGATATTACCTCTTCTTGGCCACAATCATTTTTCTCAGGGTCTATACCATAGTTCGTCTGCTAAGAAA

GTGGGTTTCTGTTTGCAAGGAGAGGGGACCCAAGTAATGAATATGAAGACTGGTTCTGAGGGTGGGCTTGATTATTTGTGAAGCCCAGCCTTCCTACATC

CCACCCTCCCTGCAGTTTAGATGTGTGTGGGACATATGTGGTCTTCCCCTTTCCTGGATCAAGGCTATGACAGGCAGGCTTCTGGTATGTGCTTGGTACA

TGTGCTGCAATACATGTGCTTGATGGTACATGCGTGCCCCTCCCCATACAGAACCTTGTACTTCAGTTATCTTTAACATAACTTAGTAGACTTTCCATCT

GTCCTAAGGCATGACTGTCAGCTTCAGCAACCTTGCTAGGTGCAGGCTGGGTACCCTGTGGCCTGAGAACTGAGCCCAGAGTTTGACCTGAACATTGAGC

CTGGACCAGGCAGAAGCTGGTCAGAATGTACTGTCTCCATTTTGGGCCAAGCCGGGACCAAACTTACTAACTCAGGCAAGCCAGGGTGAAACTTAAACCC

TCTTTTATCTTTAACCTGAATCCAGGCTGGAGTTGAAGCTCAATGATAAAGGGCTTGCCTGTCGGTCAAGAGACCCTCGGATGGATCCCAGGACTGTAAA

ATATAAATAAATAAAAATATGCCCCCTCTCTCCAACCTCTTGGAGGCAGCTGGCAGCCCAGCTCAAGGAGGCAAGAGGTTCCCCCTGGCTGCTTGCTTTA

ATTGGCCGGTGATCTCTGCCTGGTGAATTGGTTTTATAGTCTCTGAGTCCAGCCCCTGGACAACCCCTCCCCTTTGCCTCTCCAGAACTCCAGGAGCTTG

GCTGTCTCTAGTGAAGAGTGGAGATTCAGATTCTGAGGGAGGGAGGGAGGGTCTGACCTGTGTGGTGACCTGTAACCAGCTGAAGGCAACAGGCTTTTGT

GGTGTGCTGAGGATGGGGGGTGGGAGAAGAGCTGGAAAACTCTGTAGAAATGCCCTAGAGGAACAGAAGCCCTGTATTCAGGGGCCAAACTGCTCTACTA

ATTCACAATCCCCAGGAGGCATTTCTAAAAGCCAGTGAACAGATCTGGAGAGGAACATCCCCCAGTCCCGTCACTGACTCCCCCAGGGAGACTGGGGTGG

TACGCAGGAGAGTGGGGGGAGGGTGGGCACTTTGCCTGGCCCTGTCTCTCTGTTTCAAAGTTTGGCTGTGCTGTTCAGTTGTCCCCAGTGGCCTTGTCTT

GCTCAATCAGAGGTGGAAAAAGATCACCTCCCGGTGACCTCCTTCAGGCCCCAGGGGATGGGCTGTGTCCAGAGCTATGTGGCAGAGCTTGTTTCCAGAG

CCCAGAGAGGCCCCGCTGGCCTGCCTTGCTGCCCCAGTGGCGAAACGCAAGCCCAACACTGAGCATGGCAGGGAGTGGGTGTTGGGGACAGTCTAGCCAA

GGCCCCTGTCTGTCCCAAGCTTTCCAGGAACTAAGCAGTGAGGTCACTGTGACAGTCCTGCCTGGTCAGCGAGGAGAATATTCTGAGCTTTCCCGCTCTG

GGACTTACTGGGGAGGGGGCGGGTACCAGTGTATGGAGTAACAAGACATCAGCCTTCGTGGCTCTGCAGGATTTGGGGGAATCAGTACAGTGGCCACTGT

GGCTGCTATGAAGATAAGGCCTTTTGGAGACAGGCTATCCTGGCCTGATACCCTGGTTGGACCTAGAGGGATACAGGGTGGAGCCACAGTCATTTCAAGT

TCCCTGGGGTTCCTGTGGGCTGCAGACCTAGGGGACAGAGCCTCAAGGAAGACAGCAGAACAAAGCTGAGCTCTTCCATATATGCCAGCTTTGGCCAAGG

TGCTATGAGGTCTGTGACCCCAGGCTTGCACTGCCCCTTTCTCTACAGTTGTCTGATGTCCACCCCATCTCTGGGTTCACAGAAACTGACACGGGGAGAC

CCAGCGAGATGTAGCATTTCCTTCATCCCCAGTCTGGTTGGCCCGGGGTCTGGGCATCCTGCCTTAAGGAAAGGAATGGGGACCATTATTTTTTAACCTG

TATATAATATTTGACCTTTTTTTGGTTCTTTATATGTATACATGTGTAAATATCCTCTCATCCATCAAGTGGTACAGTTTTTAATAAAACCATTTAAAGC

Translation
MSPG - UNI20983 - GEMEPPQCVEELEDDVFQSEDGEPGTQPGGLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSPASPSQ

GVMLPCGVTEEPQRLFYG GNAGYRLPLPASFPAGSPLGEQPPEGQFLQHRAEVQIARKLQCIADQFHRLHTQQ - UNI16696 - HQQNRDRAWWQV

FLFLQNLALNRQENREGVGPW

For any suggestions or comments, please send an email to unitrap@crg.es