Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040123 (Zmym5)
Chromosomal location
Chr 14: 57411766 - 57430534 (-)
Description
zinc finger, MYM-type 5 Gene [Source:MGI Symbol;Acc:MGI:3041170]
RefSeq_peptide
NP_659091.3 
UniGene
Mm.409947 Mm.463204 Mm.297636 Mm.473172 
MGI
MGI:3041170 
Uniprot/SWISSPROT
Q3U2E2 
Uniprot/SPTREMBL
Q6PDL1 Q8BZ73 Q3TR70 
Human Ortholog
ENSG00000132950 (ZMYM5)
Omim not available
UniTrap UNI17408
Vector Insertion
Chr 14: 57423701 - 57429576
Public Clones IST14725G3 (tigm) IST15111C10 (tigm)
Private Clones OST443367 (lexicon) OST303057 (lexicon) OST178347 (lexicon) OST134201 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000039812
Sequence
ACCAGCGCTAAAGCCGGGACTGGACCGAGCGGAGTTGTGCGTGTCGCCGAAGGGGGGTGGGCCGGGGGAGGGGAGGTTCGTTCCGCGGAGCTGCAGCCAG

AACCCG - UNI17408 - ATTCATCAGTGGGAAGACTAGTTGACTGTACATTGGACTTGGACATGGAAGCTCATCTCGCAGATATGGAATCATCTGGG

GGTCCAACTAGTTCTTTAGCCGGTACATCTAGAAACACACATGTGGAAGATGATGATGTTGTATTTATTGAATCAGTACAGCCTCCAATTTGTGCTCCAG

CAATACCTAATGAAAGAAACTTTGTATTTGCTTCCTCAAAACATGAAAATCCACCAGGAACTGATTCCACAATTTCCCCTTCTTGGAGAGATTTGACTTC

TCAGAAGGGAAATCTATGTGAAACAATTGTAATTGATGATGAAGGGGACACAGACACAAATGGAGGGGAGGAGAAAAATCCTACCGACTTTATTGAATGG

GGACCGAATGGAAATAAAAGTAGTACCAAAAATGTGGATTTCCCCATTGCCAGTCTATCAAGAAGCAAG ACCAAGACTGCAGTAGGACCTTTTAATCCC

GGTAGGATCGATGTCACGGATGCGTTTCAGAATGGAAGATTTGCAGTTCATCACAATCCTG ATTCTTGGATCTCCCAGTCAGCATCATTTCCTCGTAAC

CAGAAACAACAAGGGGTGGATTCTTTATCACCAGTGGCCTCACTTCCTAAACAGATATTCCAGCCCTCGAACCAACAACCCACTAAACCAGTTAAAGTCA

CTTGTGCAAACTGCAAAAAACCTCTACAGAAGGGGCAGACAGCTTACCAGCGAAAAGGATCAGCTCACCTCTTCTGTTCAACCACCTGCCTTTCTTCTTT

CTCCCATAAGCGTACTCGAAAGACACGGAATGTAATGTGTAAAAA AGATTCTCCTGTGAGAACCACAACTATTGTTCCTCCAGTGGAGTCAAGCAAGTC

CTTACAAGGATTTTATAATGCATCGCTATCTCCCTATGAAAACTGCCAGAGTCTTAGGAAAGAAGTTTTTACTAAGTCAAGATGTATAATCTGTAATAAA

TTAGGAGAG GTTCGCCATGAAATCAGTGTTAACAGTATAACACATAAGCTGTGCAGTAATAATTGCTTTAATGAATACAGATTGACGAATGGTCTAATA

ATGAACTGCTGTGAACAGTGTAGCAAGTATATGCCCAAGAGTACTGGGCACAGCATTCTGATAACAGGTCAGCAAAAGAGATTCTGCTGCCAGAATTGTG

CTGACGAATATAAAGAG ATAATGGAAGCAAAATCAAAACTACTGCTTTTACAAAATAGAAAAAGGAATGCTATCAGAGAAGAAAATGAAAAACGATTAC

GTGAATCATCAGGTACACTTTCAGGAAACACAGGAGACATACCCGAAAAAAAGGAAAAGTCTTCAGAGATAATAAAAGTCGCAGCAGACTGTAGCCTAGA

TACATCATCAGAGGAACAAAATGTGAATTTACCTTGTTCTGTGGCAGTAATATCTGATACATTTAAAGAGCAACTAGGAGACAAAAATTCAGAGGAATTG

GATATGTCCATTTTACCTTCTTTGGATCCAGGTTCATGGCCCCGAATTTTGAATATGAAACAACGTGAATTTCTTGTCAAAAACAATCCACCTCAAATAA

GAAATTTTAATTTTCCAAAAGATAGTGCAGGCAAGAAGTTTTCAGAAACGTATTATACCCGAATTCTTCCAAATGGTGAAAAGGGCACCAGACCCTGGCT

GCTCTACTCAGCCTCGAAAGACTCTGTGTTTTGCCTGTATTGCAGACTCTTTGGGGAAGGAAAAAACCAACTGAGAAATGAGAATGGGTGCAAAGATTGG

CATCATTTGTCACATCTTCTTAGTAAACATGACGAAAGTGAAATGCACATCAACAATAGTGTTAAGTATTCAAAATTAAAGTCTGACTTGGAAAATAAAA

CCAATGAAGCTACAGAAGGTGGGGAAGATTGTGTGCAGCTACTGTACACATAATGTCCTGTCTGCTCTACTTATGGCAGTGTCTGCAGTACCCAGACATA

CACTGTGTAAGAGGACCTTACAGGAGCTCATTAGCAATATGTCTAACAGCAAACAAATAGTAAAAAATGCTCCTGTTCTAAACCTAAAAGCAATTTTCGA

GAGTGTAGTCATTCTTGCAGACTTTAGCAAAGGCAGTTTGAGCTTTGTCACTGTTAGGGTTTCCACCTTGTAAAATGTTGTTGGAGAACTTGCACTTAAT

GGCCTAAGAGCAAGAGGTGGCAAGATGCATATGTAACAAGCTAAAGAAAATGCATTCAGGCCACATGGTGGCGGTGTGCACCTTTAATCTCAGCACTCAG

ACACAGAGAGTTGGATATCTGTGAGCTCTAGGCCAGCCTGGTCTGCAGAGCAAGTTCCAGGAGAGCCAAGGTATACACAAACCCTGTCTTG
Translation
 - UNI17408 - MEAHLADMESSGGPTSSLAGTSRNTHVEDDDVVFIESVQPPICAPAIPNERNFVFASSKHENPPGTDSTISPSWRDLTSQKGNLCE

TIVIDDEGDTDTNGGEEKNPTDFIEWGPNGNKSSTKNVDFPIASLSRSK TKTAVGPFNPGRIDVTDAFQNGRFAVHHNPD DSWISQSASFPRNQKQQG

VDSLSPVASLPKQIFQPSNQQPTKPVKVTCANCKKPLQKGQTAYQRKGSAHLFCSTTCLSSFSHKRTRKTRNVMCKK KDSPVRTTTIVPPVESSKSLQG

FYNASLSPYENCQSLRKEVFTKSRCIICNKLGE VRHEISVNSITHKLCSNNCFNEYRLTNGLIMNCCEQCSKYMPKSTGHSILITGQQKRFCCQNCADE

YKE IMEAKSKLLLLQNRKRNAIREENEKRLRESSGTLSGNTGDIP
Transcript ENSMUST00000111285
Sequence
GCGTCGGGAGCCTCCCACCGAGCCGGGCTTAACAGCCCGCGGCGGCCGGTGTCGCGGCTGCTGCGTCGGGGCCTGAGGGTGCGCTGGGGGCCGCGCTGAT

GTCCAGGGCGGCTTCGCGTGCGGCCGGAGGG ATTCGAGGACGCGTTTACTCTTCGACTCAGCTGCGCGCTCTACTCATAATTCTGAAACTGGAAAGAAC

ATATGAGCTTGGCCTGCTGTCGTTTAGTTGATCTATTGTTTATTTGGAGAAG - UNI17408 - ATTCATCAGTGGGAAGACTAGTTGACTGTACATT

GGACTTGGACATGGAAGCTCATCTCGCAGATATGGAATCATCTGGGGGTCCAACTAGTTCTTTAGCCGGTACATCTAGAAACACACATGTGGAAGATGAT

GATGTTGTATTTATTGAATCAGTACAGCCTCCAATTTGTGCTCCAGCAATACCTAATGAAAGAAACTTTGTATTTGCTTCCTCAAAACATGAAAATCCAC

CAGGAACTGATTCCACAATTTCCCCTTCTTGGAGAGATTTGACTTCTCAGAAGGGAAATCTATGTGAAACAATTGTAATTGATGATGAAGGGGACACAGA

CACAAATGGAGGGGAGGAGAAAAATCCTACCGACTTTATTGAATGGGGACCGAATGGAAATAAAAGTAGTACCAAAAATGTGGATTTCCCCATTGCCAGT

CTATCAAGAAGCAAG ACCAAGACTGCAGTAGGACCTTTTAATCCCGGTAGGATCGATGTCACGGATGCGTTTCAGAATGGAAGATTTGCAGTTCATCAC

AATCCTG ATTCTTGGATCTCCCAGTCAGCATCATTTCCTCGTAACCAGAAACAACAAGGGGTGGATTCTTTATCACCAGTGGCCTCACTTCCTAAACAG

ATATTCCAGCCCTCGAACCAACAACCCACTAAACCAGTTAAAGTCACTTGTGCAAACTGCAAAAAACCTCTACAGAAGGGGCAGACAGCTTACCAGCGAA

AAGGATCAGCTCACCTCTTCTGTTCAACCACCTGCCTTTCTTCTTTCTCCCATAAGCGTACTCGAAAGACACGGAATGTAATGTGTAAAAA AGATTCTC

CTGTGAGAACCACAACTATTGTTCCTCCAGTGGAGTCAAGCAAGTCCTTACAAGGATTTTATAATGCATCGCTATCTCCCTATGAAAACTGCCAGAGTCT

TAGGAAAGAAGTTTTTACTAAGTCAAGATGTATAATCTGTAATAAATTAGGAGAG GTTCGCCATGAAATCAGTGTTAACAGTATAACACATAAGCTGTG

CAGTAATAATTGCTTTAATGAATACAGATTGACGAATGGTCTAATAATGAACTGCTGTGAACAGTGTAGCAAGTATATGCCCAAGAGTACTGGGCACAGC

ATTCTGATAACAGGTCAGCAAAAGAGATTCTGCTGCCAGAATTGTGCTGACGAATATAAAGAG ATAATGGAAGCAAAATCAAAACTACTGCTTTTACAA

AATAGAAAAAGGAATGCTATCAGAGAAGAAAATGAAAAACGATTACGTGAATCATCAGGTACACTTTCAGGAAACACAGGAGACATACCCGAAAAAAAGG

AAAAGTCTTCAGAGATAATAAAAGTCGCAGCAGACTGTAGCCTAGATACATCATCAGAGGAACAAAATGTGAATTTACCTTGTTCTGTGGCAGTAATATC

TGATACATTTAAAGAGCAACTAGGAGACAAAAATTCAGAGGAATTGGATATGTCCATTTTACCTTCTTTGGATCCAGGTTCATGGCCCCGAATTTTGAAT

ATGAAACAACGTGAATTTCTTGTCAAAAACAATCCACCTCAAATAAGAAATTTTAATTTTCCAAAAGATAGTGCAGGCAAGAAGTTTTCAGAAACGTATT

ATACCCGAATTCTTCCAAATGGTGAAAAGGGCACCAGACCCTGGCTGCTCTACTCAGCCTCGAAAGACTCTGTGTTTTGCCTGTATTGCAGACTCTTTGG

GGAAGGAAAAAACCAACTGAGAAATGAGAATGGGTGCAAAGATTGGCATCATTTGTCACATCTTCTTAGTAAACATGACGAAAGTGAAATGCACATCAAC

AATAGTGTTAAGTATTCAAAATTAAAGTCTGACTTGGAAAATAAAACCAATGAAGCTACAGAAGGTGGGGAAGATTGTGTGCAGCTACTGTACACATAAT

GTCCTGTCTGCTCTACTTATGGCAGTGTCTGCAGTACCCAGACATACACTGTGTAAGAGGACCTTACAGGAGCTCATTAGCAATATGTCTAACAGCAAAC

AAATAGTAAAAAATGCTCCTGTTCTAAACCTAAAAGCAATTTTCGAGAGTGTAGTCATTCTTGCAGACTTTAGCAAAGGCAGTTTGAGCTTTGTCACTGT

TAGGGTTTCCACCTTGTAAAATGTTGTTGGAGAACTTGCACTTAATGGCCTAAGAGCAAGAGGTGGCAAGATGCATATGTAACAAGCTAAAGAAAATGCA

TTCAGGCCACATGGTGGCGGTGTGCACCTTTAATCTCAGCACTCAGACACAGAGAGTTGGATATCTGTGAGCTCTAGGCCAGCCTGGTCTGCAGAGCAAG

TTCCAGGAGAGCCAAGGTATACACAAACCCTGTCTTGAAAAACCAAAAAGAAGGAAAAAAAGAAGAAAGTGCATTCAAACAGCTTAAGAAGCAACAGCTG

TTTGTTATTAAACCAAATTGAGTTTTATTTCTTTAAAACATTTTTTGTGCAAAACAGTTATTTGTTGTGGTAAATAGAAGTAATTTGTGTTTTATTGATT

TTATATTTCTGTTTCCAACTTAATGTGTAAATGTTTTAGTTTTGTTATGAGAATTATAAAGAATATATAGTTATTAGTATAAATATAAGAATTAAAATGT

GGTATGTATATGTGTGTATACATATATATATGTATGTATATATAGTTAACTTTTCAGTGTTGTTAATTTTTCTTGTGAAAGTATACTCTATGTGTGAAAT

TTGAGAAAGTATGAATCTAAAAAAAAATTTCTTCAG
Translation
  - UNI17408 -     MNCCEQCSKYMPKSTGHSILITGQQKRFCCQNCADEYKE IMEAKSKLLLLQNRKRNAIREENEKRLRESSGTLSGNTGDI

PEKKEKSSEIIKVAADCSLDTSSEEQNVNLPCSVAVISDTFKEQLGDKNSEELDMSILPSLDPGSWPRILNMKQREFLVKNNPPQIRNFNFPKDSAGKKF

SETYYTRILPNGEKGTRPWLLYSASKDSVFCLYCRLFGEGKNQLRNENGCKDWHHLSHLLSKHDESEMHINNSVKYSKLKSDLENKTNEATEGGEDCVQL

LYT

For any suggestions or comments, please send an email to unitrap@crg.es