Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040151 (Hs2st1)
Chromosomal location
Chr 3: 144094079 - 144233103 (-)
Description
heparan sulfate 2-O-sulfotransferase 1 Gene [Source:MGI Symbol;Acc:MGI:1346049]
RefSeq_dna
NM_011828 
RefSeq_peptide
NP_035958.3 
UniGene
Mm.12863 Mm.465855 Mm.465945 
MGI
MGI:1346049 
Uniprot/SWISSPROT
Q8R3H7 
Human Ortholog
ENSG00000153936 (HS2ST1)
Omim not available
UniTrap UNI36076
Vector Insertion
Chr 3: 144128727 - 144233104
Public Clones (ggtc) IST12019A9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27165
Vector Insertion
Chr 3: 144128250 - 144128727
Public Clones not available
Private Clones OST68006 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34686
Vector Insertion
Chr 3: 144100558 - 144110373
Public Clones IST11442E1 (tigm) IST11204A2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 55% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34428
Vector Insertion
Chr 3: 144098425 - 144100657
Public Clones IST12137G2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33410
Vector Insertion
Chr 3: 144094078 - 144098584
Public Clones IST12548G11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000043325
Sequence
GCGAGGGAAGAGGGCGTGCGGCCGTGGGGTCCCGAAGCCAGGGGGCAGCGGCAGCGGCAGCGGCAGGAGGGCGCCAGGGCCGTCGAGTGGGCCGGGGAGA

AGCGTGCACCAGGCGGCCGGCGCTGGCTCCCGCGGGCGGGAGACCGGAGAGGAGGAGGGGGTCGCTGCGGCGCGGCAGTCCGCGCAGCTCCCGGGTCGGG

GTCTCCTCCCGGCGCTTCGGTCGCCCTCGGGGCCCCGCTCCCCGCCCCCCGCGGTATGTCTTGATCGCGAGCGGCGGGTTTCATGGGGCTCCTCAGGATT

ATGATGCCGCCCAAGTTGCAGCTGCTGGCGGTGGTGGCCTTCGCGGTGGCGATGCTCTTCTTGGAGAACCAGATCCAGAAGCTGGAGGAGTCCCGGGCGA

AGCTAG - UNI27165 - - UNI36075 - AAAGGGCAATTGCAAGGCACGAAGTCCGAGAAATTGAACAGCGCCATACAATGGATGGCCCTCGGCA

GGATGCAACTCTGGATGAAGAAGAAGACATAATCATCATTTATAACAGAGTGCCCAAAACTGCAAGCACCTCGTTCACCAATATAGCCTACGACCTGTGT

GCAAAGAATAGATACCATGTTCTTCACATCAACACTACCAAAAATAACCCAGTAATGTCATTGCAAGATCAG GTGCGCTTTGTGAAGAACATAACCACC

TGGAACGAGATGAAGCCAGGCTTCTATCACGGACACATCTCTTACTTGGATTTTGCAAA - UNI34686 - ATTCGGTGTGAAGAAGAAACCAATTTA

TATCAATGTCATCAGGGACCCTATTGAGAGGCTAGTTTCCTACTATTACTTCCTGAGGTTTGGAGATGATTACAGACCAGGATTAAGGAGACGGAAACAA

GGAGACAAAAAG - UNI34428 - - UNI34686 - ACCTTCGATGAATGTGTGGCTGAGGGCGGCTCCGACTGTGCTCCAGAGAAGCTCTGGCTTC

AGATCCCGTTCTTCTGTGGCCACAGCTCAGAATGCTG - UNI33410 - - UNI34428 - - UNI34686 - GAATGTAGGGAGCAGATGGGCCA

TGGACCAGGCTAAGTCTAACCTCATTAATGAGTACTTCCTGGTGGGAGTCACCGAGGAGCTCGAGGACTTCATCATGCTGCTCGAGGCAGCTTTGCCCCG

ATTCTTCCGGGGCGCTACCGACCTCTACCGTACAG - UNI33410 - - UNI34428 - GAAAGAAATCTCACCTTAGGAAAACCACAGAGAAGAAG

CTGCCCACCAAGCAGACTATCGCGAAGCTGCAGCAGTCTGACATTTGGAAGATGGAGAATGAGTTCTATGAGTTTGCTCTGGAGCAGTTCCAGTTCATCC

GAGCTCACGCTGTCCGCGAGAAAGACGGAGACCTCTACATCCTGGCCCAGAACTTTTTCTACGAAAAGATTTACCCTAAGTCGAACTGAGCGCAGGTGTG

GCCAGAGCACTCCTGCCCCGGAACTTGACTGTGTCACCACCCTTCTCAGCCCCCTGCTGATGCGTGTGCGAGCTGTGAGCCACGCTGAGCTGGGGACAGA

CATGAATGTCAAGGAGTGAGATGCTGGCGGGCTGGCGGAGTCCTGTGGAGTTTTTAACTTTCTGGCATTTTTACTTTTTTGTTGTTTTATTTTCGTTTTC

ATGATAGTTATAATCTTCTCCTGGTGCAGGGACATGGGGACTTACATTGCCTAAAATACACACATGGACGTTTAGTCAGATGGCTGAATACCATTTCAGA

AGAGGTTTGCATAAGCATTTCTTTGCCTCTCCTTGAATGAAGAGGAGTCTGTTTGCCACTTACCCTTCTGGAGTTTGTGCCGCCACCTCTGCTGGATAGT

GCTAAAATATGTTTGGCAGTATCTGATTTATTTGTATGAATCATGTCTCACAAAGTTTATTAGAATGTTTGATCGTGTTTTCCCAGAACATTTCTGCTAC

AGTTGGGTTTGCCCATATTTATGTAGGCTTTATTTTATTTTATTTGATGATCATTAGTGTTAAAGAAATCAACTTAAACCATGAATAATACTGTAAGAAG

GTAAAAAGTTAAAGCAGTATTCCTGACTCCTGTCACCCCAGTATCCAATATTGGAATGATATTTCTAAGAATGTGGACATTATCTGAGGCTTTCTTAAGG

ATTTCCACATATCAATATCAAAAAATTGAGTTTAATACTTGTTCCTTCATGGCGTATCTGTACCCCTGAACACTGGCATATTGGTGACCGCACATGGCGA

CTCCATCAGTGAGCTGTGATGTGGGTAGGATTTGCCTACTCTGTACTTTTACCTGTAGACTATTTTTACTACGGTGCTTTATAATGTGTTTTAAAGCATT

GCATTTACAAAAGGAAAGTGCTGTAAATATTGCATATTTTATGTATTTGGACCAAAAAGTTACAAGTAAGTAGACAACAGTGGTGTTGCACCCGTTTTAT

TATGTCGAGTAAAGTCGTCAGACCTCCTATCCTATTCTGGTATTTCTCGTTTAACGTTACTGTTAGGATGTCACTAAAATGAGCTAACGTAGCCTTTCAA

GTTTGATAGAGAACAGTGCTCACCCCTGAGGCAGTAGTGGTCATAGAAAAGGTCGTAGAGTCTGAGGGTTCCATCTCTGGTTCCAGCTCTGCTGTCACCT

TCCTGCTGTGTGACGTTAGGAAGTCACCTGACCTCCCTGCCTCAGCTTCCTCATCTTGATATCAGGACACTAAGACCTTCTCTCCCTGCCTCACAGGGAT

GTTGTGAGGACTAAGGAAGATGGCATGGCGAAGAGCACTTTAAAACTGTGGCGTGGTGTTCAAATGTGAGGTGTTGTCACAGAAGTATCTCTAGCTGATA

GTTTCATAGTCTCTATTTTAGCAACAAAAAGGGAAAATCCACTTTTAAGCTTTATGAGAAAAAAAACCCCTTCCTCTTGATATAAATTTGTGTTTGATAA

ATATCTTCTCAGTGTTTTATCTTCTGTGCTTAAGCAACTATTGAAGTGTGAACGGCTTATGCACTCGAGAGACTCAGACCGTCACTAGCTGAGGAGCAGG

AAAGCCTTCTATAAACTTGAAGGATGTTCTTGTTTGTATCTAACTTTGTCATCCGAAAATGGTGGCTATTTTACACTTGTGCTTGTTAAAGTGTCCTTTG

TAGAATTTAATTTCTCTATTAATTCTTCACCTACTCCCTCTTTACAGCCAGGATTCAGATTCCTCTCAGACACACTTTTCTAAAGGAGTAATTATTTGTA

TCTTTAAATGTTTCTAAACAGGACCTCATCAAACAAAGCATTTTCAACAGAAGACTTTAAAGTATTTATTGTGTAATAGGAGGAGTGAAGGACACTGTAT

ATCAGAAAGCACTTAGGAAGATTAAAGGAACGACTGAGTCACAGGCTCCGCCGAGATGAAAGTATTAGGGGAACATAGCAACGTTTCCCTTCCCCCTCCG

TCCTTTCCAGTGCAAGTTTCTAGGTCCTGCTAAAAGCAAGTTGTTTTCTTGTCCAGGCAGGCATCTGGCTGTTGAGTAAATCTGAGGTTATTCTTGAGAG

TTCGCACTAAACTCTTAGGTAGTTAAGGCAGCACTTAGAACACTAACTGGGACTTTCCCTAAACTGTCCTCATAAAAGACCAGGTAATGAGTCAGGTCTC

TGTACAGCTCTTACTGTTGGAAAGTCGCTGTCACAGACAGGAGAGGCAAAGGGCCGTGGTTAGAGCTTAGCAAAACCTTTATTTACAGAACAGAAGGCAT

ACTAGATATGAACCATGAGCCGCAAGCCCTCGCTCACCCTGTGAGGGATTGTCATGGAGAAGCCCTGTCTGTGTCCGGACCACGTTCCCCAAAGAGTTCC

TCTACCTCCCATGTCTCCCAGATCGTGACCCCAAGGACTGCTTTCTGACTCAGTCCCTCCCCAGCTTCCTTCTGTCTTACCTTGCTGTCAGGTGACTCGT

TTTCCTAGCTCACCTGTACAGATTCGGGACATTTCTTTTATCGCTTTTTGGAGCGAATGGATTCCAAGTGTCCTTTCTGGAGACTAAGAAAAGGGTGGGC

TTGCTTCTCTAAGAGTCCTGGGAGCCTGAGTCCTTAGAACATATAACTGTGTAATCAAATGAATAGAACCACTGAGACAATGTGTATTTTTTACATGTGG

CAAATGCTTTTCTTTTTTTGGCCTTTGTGCTTTTTCAGTAATTTGACCTTAGAAAAAAATGGTTTTTATATGATAGTAAAGCAAAATAACCACTTTGAAT

TTTAACGATAATGTCAATGTGTGTGTGTGTCTATGTTTATTTCCTACAGAAGAAGAGGTAGCTTTGTGTGTTCAGCTTGTACCAACCGTCTTCTTATTGC

TGAGAAATGGCCACTATTGATAAACCTTTCTGTTTTAAAATGTAGTGGGGAGGTTATGTTTTGATCTCCTCTGGCTTTAATTTCTAGTGTCACTTGAATA

TATCTGGTAGCAAACCTTGAAGCACCGCATAGGAGCTGCTTCTGTGTCCCCTGATAGTCACACAGTCCCTAACATCCGCTGCTTCTGGCCTCCTGAGCAT

TGGATTTAAATATCCAAAACCCTCAAAACTCCAAGTTGCCAGCTTTTTAAACACTTGCTTTTCCCTTCTGTGCTGAAAATCCAGATAGCACCTATAATTT

GGACTCTATTGATCTTCCTCATTATGTGTCCTGTTGGAAACCCCTAAAATTGTCTGCTCCATCAGGGAACTTACCAGAGTATTTTGATGTTGTATTTGCA

TAGATGGATATGAAATAGTTTATAGATGACAATTCTCTTTTTTGAATAAAATGAAATTTTTG
Translation
MGLLRIMMPPKLQLLAVVAFAVAMLFLENQIQKLEESRAKLE - UNI27165 - - UNI36075 - ERAIARHEVREIEQRHTMDGPRQDATLDEEE

DIIIIYNRVPKTASTSFTNIAYDLCAKNRYHVLHINTTKNNPVMSLQDQ VRFVKNITTWNEMKPGFYHGHISYLDFAK - UNI34686 - KFGVKKK

PIYINVIRDPIERLVSYYYFLRFGDDYRPGLRRRKQGDKK - UNI34428 - - UNI34686 - TFDECVAEGGSDCAPEKLWLQIPFFCGHSSECW

 - UNI33410 - - UNI34428 - - UNI34686 - WNVGSRWAMDQAKSNLINEYFLVGVTEELEDFIMLLEAALPRFFRGATDLYRTG - UNI

33410 - - UNI34428 - GKKSHLRKTTEKKLPTKQTIAKLQQSDIWKMENEFYEFALEQFQFIRAHAVREKDGDLYILAQNFFYEKIYPKSN
Transcript ENSMUST00000088088
Sequence
CTTGAGGCAATGAGAGCTCCGTTAG - UNI27165 - - UNI36075 - AAAGGGCAATTGCAAGGCACGAAGTCCGAGAAATTGAACAGCGCCATA

CAATGGATGGCCCTCGGCAGGATGCAACTCTGGATGAAGAAGAAGACATAATCATCATTTATAACAGAGTGCCCAAAACTGCAAGCACCTCGTTCACCAA

TATAGCCTACGACCTGTGTGCAAAGAATAGATACCATGTTCTTCACATCAACACTACCAAAAATAACCCAGTAATGTCATTGCAAGATCAG GTGCGCTT

TGTGAAGAACATAACCACCTGGAACGAGATGAAGCCAGGCTTCTATCACGGACACATCTCTTACTTGGATTTTGCAAA - UNI34686 - ATTCGGTG

TGAAGAAGAAACCAATTTATATCAATGTCATCAGGGACCCTATTGAGAGGCTAGTTTCCTACTATTACTTCCTGAGGTTTGGAGATGATTACAGACCAGG

ATTAAGGAGACGGAAACAAGGAGACAAAAAG - UNI34428 - - UNI34686 - ACCTTCGATGAATGTGTGGCTGAGGGCGGCTCCGACTGTGCT

CCAGAGAAGCTCTGGCTTCAGATCCCGTTCTTCTGTGGCCACAGCTCAGAATGCTG - UNI33410 - - UNI34428 - - UNI34686 - GAAT

GTAGGGAGCAGATGGGCCATGGACCAGGCTAAGTCTAACCTCATTAATGAGTACTTCCTGGTGGGAGTCACCGAGGAGCTCGAGGACTTCATCATGCTGC

TCGAGGCAGCTTTGCCCCGATTCTTCCGGGGCGCTACCGACCTCTACCGTACAG - UNI33410 - - UNI34428 - GAAAGAAATCTCACCTTAG

GAAAACCACAGAGAAGAAGCTGCCCACCAAGCAGACTATCGCGAAGCTGCAGCAGTCTGACATTTGGAAGATGGAGAATGAGTTCTATGAGTTTGCTCTG

GAGCAGTTCCAGTTCATCCGAGCTCACGCTGTCCGCGAGAAAGACGGAGACCTCTACATCCTGGCCCAGAACTTTTTCTACGAAAAGATTTACCCTAAGT

CGAACTGAGCGCAGGTGTGGCCAGAGCACTCCTGCCCCGGAACTTGACTGTGTCACCACCCTTCTCAGCCCCCTGCTGATGCGTGTGCGAGCTGTGAGCC

ACGCTGAGCTGGGGACAGACATGAATGTCAAGGAGTGAGATGCTGGCGGGCTGGCGGAGTCCTGTGGAGTTTTTAACTTTCTGGCATTTTTACTTTTTTG

TTGTTTTATTTTCGTTTTCATGATAGTTATAATCTTCTCCTGGTGCAGGGACATGGGGACTTACATTGCCTAAAATACACACATGGACGTTTAGTCAGAT

GGCTGAATACCATTTCAGAAGAGGTTTGCATAAGCATTTCTTTGCCTCTCCTTGAATGAAGAGGAGTCTGTTTGCCACTTACCCTTCTGGAGTTTGTGCC

GCCACCTCTGCTGGATAGTGCTAAAATATGTTTGGCAGTATCTGATTTATTTGTATGAATCATGTCTCACAAAGTTTATTAGAATGTTTGATCGTGTTTT

CCCAGAACATTTCTGCTACAGTTGGGTTTGCCCATATTTATGTAGGCTTTATTTTATTTTATTTGATGATCATTAGTGTTAAAGAAATCAACTTAAACCA

TGAATAATACTGTAAGAAGGTAAAAAGTTAAAGCAGTATTCCTGACTCCTGTCACCCCAGTATCCAATATTGGAATGATATTTCTAAGAATGTGGACATT

ATCTGAGGCTTTCTTAAGGATTTCCACATATCAATATCAAAAAATTGAGTTTAATACTTGTTCCTTCATGGCGTATCTGTACCCCTGAACACTGGCATAT

TGGTGACCGCACATGGCGACTCCATCAGTGAGCTGTGATGTGGGTAGGATTTGCCTACTCTGTACTTTTACCTGTAGACTATTTTTACTACGGTGCTTTA

TAATGTGTTTTAAAGCATTGCATTTACAAAAGGAAAGTGCTGTAAATATTGCATATTTTATGTATTTGGACCAAAAAGTTACAAGTAAGTAGACAACAGT

GGTGTTGCACCCGTTTTATTATGTCGAGTAAAGTCGTCAGACCTCCTATCCTATTCTGGTATTTCTCGTTTAACGTTACTGTTAGGATGTCACTAAAATG

AGCTAACGTAGCCTTTCAAGTTTGATAGAGAACAGTGCTCACCCCTGAGGCAGTAGTGGTCATAGAAAAGGTCGTAGAGTCTGAGGGTTCCATCTCTGGT

TCCAGCTCTGCTGTCACCTTCCTGCTGTGTGACGTTAGGAAGTCACCTGACCTCCCTGCCTCAGCTTCCTCATCTTGATATCAGGACACTAAGACCTTCT

CTCCCTGCCTCACAGGGATGTTGTGAGGACTAAGGAAGATGGCATGGCGAAGAGCACTTTAAAACTGTGGCGTGGTGTTCAAATGTGAGGTGTTGTCACA

GAAGTATCTCTAGCTGATAGTTTCATAGTCTCTATTTTAGCAACAAAAAGGGAAAATCCACTTTTAAGCTTTATGAGAAAAAAAACCCCTTCCTCTTGAT

ATAAATTTGTGTTTGATAAATATCTTCTCAGTGTTTTATCTTCTGTGCTTAAGCAACTATTGAAGTGTGAACGGCTTATGCACTCGAGAGACTCAGACCG

TCACTAGCTGAGGAGCAGGAAAGCCTTCTATAAACTTGAAGGATGTTCTTGTTTGTATCTAACTTTGTCATCCGAAAATGGTGGCTATTTTACACTTGTG

CTTGTTAAAGTGTCCTTTGTAGAATTTAATTTCTCTATTAATTCTTCACCTACTCCCTCTTTACAGCCAGGATTCAGATTCCTCTCAGACACACTTTTCT

AAAGGAGTAATTATTTGTATCTTTAAATGTTTCTAAACAGGACCTCATCAAACAAAGCATTTTCAACAGAAGACTTTAAAGTATTTATTGTGTAATAGGA

GGAGTGAAGGACACTGTATATCAGAAAGCACTTAGGAAGATTAAAGGAACGACTGAGTCACAGGCTCCGCCGAGATGAAAGTATTAGGGGAACATAGCAA

CGTTTCCCTTCCCCCTCCGTCCTTTCCAGTGCAAGTTTCTAGGTCCTGCTAAAAGCAAGTTGTTTTCTTGTCCAGGCAGGCATCTGGCTGTTGAGTAAAT

CTGAGGTTATTCTTGAGAGTTCGCACTAAACTCTTAGGTAGTTAAGGCAGCACTTAGAACACTAACTGGGACTTTCCCTAAACTGTCCTCATAAAAGACC

AGGTAATGAGTCAGGTCTCTGTACAGCTCTTACTGTTGGAAAGTCGCTGTCACAGACAGGAGAGGCAAAGGGCCGTGGTTAGAGCTTAGCAAAACCTTTA

TTTACAGAACAGAAGGCATACTAGATATGAACCATGAGCCGCAAGCCCTCGCTCACCCTGTGAGGGATTGTCATGGAGAAGCCCTGTCTGTGTCCGGACC

ACGTTCCCCAAAGAGTTCCTCTACCTCCCATGTCTCCCAGATCGTGACCCCAAGGACTGCTTTCTGACTCAGTCCCTCCCCAGCTTCCTTCTGTCTTACC

TTGCTGTCAGGTGACTCGTTTTCCTAGCTCACCTGTACAGATTCGGGACATTTCTTTTATCGCTTTTTGGAGCGAATGGATTCCAAGTGTCCTTTCTGGA

GACTAAGAAAAGGGTGGGCTTGCTTCTCTAAGAGTCCTGGGAGCCTGAGTCCTTAGAACATATAACTGTGTAATCAAATGAATAGAACCACTGAGACAAT

GTGTATTTTTTACATGTGGCAAATGCTTTTCTTTTTTTGGCCTTTGTGCTTTTTCAGTAATTTGACCTTAGAAAAAAATGGTTTTTATATGATAGTAAAG

CAAAATAACCACTTTGAATTTTAACGATAATGTCAATGTGTGTGTGTGTCTATGTTTATTTCCTACAGAAGAAGAGGTAGCTTTGTGTGTTCAGCTTGTA

CCAACCGTCTTCTTATTGCTGAGAAATGGCCACTATTGATAAACCTTTCTGTTTTAAAATGTAGTGGGGAGGTTATGTTTTGATCTCCTCTGGCTTTAAT

TTCTAGTGTCACTTGAATATATCTGGTAGCAAACCTTGAAGCACCGCATAGGAGCTGCTTCTGTGTCCCCTGATAGTCACACAGTCCCTAACATCCGCTG

CTTCTGGCCTCCTGAGCATTGGATTTAAATATCCAAAACCCTCAAAACTCCAAGTTGCCAGCTTTTTAAACACTTGCTTTTCCCTTCTGTGCTGAAAATC

CAGATAGCACCTATAATTTGGACTCTATTGATCTTCCTCATTATGTGTCCTGTTGGAAACCCCTAAAATTGTCTGCTCCATCAGGGAACTTACCAGAGTA

TTTTGATGTTGTATTTGCATAGATGGATATGAAATAGTTTATAGATGACAATTCTCTTTTTTGAATAAAATGAAATTTTTG
Translation
LEAMRAPLE - UNI27165 - - UNI36075 - ERAIARHEVREIEQRHTMDGPRQDATLDEEEDIIIIYNRVPKTASTSFTNIAYDLCAKNRYHVL

HINTTKNNPVMSLQDQ VRFVKNITTWNEMKPGFYHGHISYLDFAK - UNI34686 - KFGVKKKPIYINVIRDPIERLVSYYYFLRFGDDYRPGLRR

RKQGDKK - UNI34428 - - UNI34686 - TFDECVAEGGSDCAPEKLWLQIPFFCGHSSECW - UNI33410 - - UNI34428 - - UNI3

4686 - WNVGSRWAMDQAKSNLINEYFLVGVTEELEDFIMLLEAALPRFFRGATDLYRTG - UNI33410 - - UNI34428 - GKKSHLRKTTEK

KLPTKQTIAKLQQSDIWKMENEFYEFALEQFQFIRAHAVREKDGDLYILAQNFFYEKIYPKSN

For any suggestions or comments, please send an email to unitrap@crg.es