Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040167 (Ikzf5)
Chromosomal location
Chr 7: 138532164 - 138554011 (-)
Description
IKAROS family zinc finger 5 Gene [Source:MGI (curated);Acc:Ikzf5-001]
RefSeq_dna
NM_175115 
RefSeq_peptide
NP_780324.2 
UniGene
Mm.334273 Mm.389431 
MGI
MGI:1914393 
Uniprot/SWISSPROT
Q8BU00 
Human Ortholog
ENSG00000095574 (IKZF5)
Omim not available
UniTrap UNI2250
Vector Insertion
Chr 7: 138553900 - 138553993
Public Clones AL0096 (sanger) RRU421 (baygenomics) XB583 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI165
Vector Insertion
Chr 7: 138540182 - 138540366
Public Clones GC0161 (tigem)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30259
Vector Insertion
Chr 7: 138540182 - 138553993
Public Clones D056B12 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33211
Vector Insertion
Chr 7: 138532163 - 138537452
Public Clones IST10124B10 (tigm) IST10124A9 (tigm) IST10124A10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000046306
Sequence
CAGCTGCGACGCTGACGAACGCTGAGGCGGTGGCGGTGGCGGCGACGGCAGTGAAAAGGGCTGTGGGGATTCCTCGGTGCGGTTGTCAGGAG - UNI16

5 - - UNI2250 - - UNI30259 - ATATAACAGACTTTCAACTTAAAGAAAGAAAGAAAAAAAAAAGCACCAAGATGGGTGAAAAGAAACCAGAG

CCTTTGGACTTTGTAAAAGATTTCCAGGAATACCTGACCCAGCAGACGCATCATGTGAACATGATTTCGGGATCAGTTAGTGGGGACAAAGAAGCAGAGA

CTCTTCAGGGAG - UNI165 - - UNI30259 - - UNI33211 - CTGGAACAGATGGCGATCAGAATGGCCTTGATCACCCGTCTGTTGAAGTT

TCCCTGGATGAAAACTCAGGAATGTTAGTAGACGGGTTTGAGAGGACCTTCGATGGGAAGCTCAAGTGTCGGTACTGCAACTATGCCAGCAAAGGAACGG

CCAGGCTCATTGAGCACATCAGGATCCACACAG - UNI33211 - GCGAGAAGCCTCACAGGTGTCACTTATGTCCATTTGCATCTGCTTACGAGCGC

CACCTGGAAGCCCATATGCGCTCTCACACTGGGGAAAAACCATACAAATGTGAATTGTGCTCCTTCCGCTGCAGTGACCGAAGTAACCTGTCCCACCATC

GAAGGCGCAAACATAAAATGGTACCAATTAAAGGTACCAGGTCTTCCTTAAGCAGCAAGAAAATGTGGGGGGTTTTACAAAAGAAAACAAGCAATCTGGG

GTATAGCAGAAGAGCACTAATCAACTTAAGTCCACCTTCCATGGTGGTCCAGAAACCAGACTACCTTAATGATTTTACACACGAAATCCCAAATATTCAG

ACTGACTCCTATGAAGCTATGGCTAAAACTACACCAACTGGTGGCCTGCCAAGGGACCCCCAAGAACTCATGGTTGACAACCCTTTGAATCAGCTCTCTA

CTTTAGCAGGACAGTTGTCCAGCTTGCCACCAGAAAACCAAAACCCTGCCTCTCCTGATGTAGATGCCTGCCCTGATGAAAAGCCTTTCATGATTCAGCA

ACCCTCTGCCCAAGCAGTTGTCTCTGCTGTGTCAGCAAGTATTCCTCAGAGCTCCTCCCCCACAAGTCCGGAACCGCGGCCATCGCATAGTCAGAGGAAC

TACAGTCCAGTGGCAGGGCCCAGCAGTGAACCAAGTGCCCACACCAGTACTCCCAGCATAGGAAACAGCCAGCCAAGCACTCCAGCTCCAACCCTGCCGG

TGCAGGATCCTCAGCTTCTACACCACTGCCAGCACTGTGACGTGTACTTTGCAGACAACGTCCTTTACACTGTCCACATGGGGTGCCATGGGTATGACAG

CCCCTTTCAGTGTAACGTATGTGGGTGCAAATGTAAAGACAAGTACGATTTTGCCTGTCATTTTGCAAGAGGGCAACACAACCAGCACTGAACACAATCA

ACATTGTTCTCACTTGGTTTGGCCTTTTGGGAGTTTGTAGTTTGGTTTTTAGTTTGATCATCCCTAATAAGGTATATGCTAATTTAAAATTTATACATTC

TAGTCTATAAAATAGAAGTTTGATAGTGAAAAAGGGTTTTGTTAACTTTTCATAAAAGTCTGGTCAGGGTTATTTATGCATTAGATAGTTAGATGCATTG

CTGTCTTTTTCATTTACACCTATGAGAGTTAAAGTACAGTTGTAATCAGTTTCCTACACTTGTCCATAAGGATTCCCAGGGTTATCTGTACTCCTGATGC

TTCAGGATATACATTACAGCTAATGTTCTTTCTGCCATATGTCAAAATGGCACACTTCTCATAAAATCTTTTATAACATTTCAGTGTTTATAGACAAACT

GCCTTTAAGTTTGCTCCTAATTAAAATACTATTTTCATTCACATAACTTAAGTTGAATTAGTTTCATTACAACCAAAACCAGTAGTTATTTCAGTGTAAT

AAATATTTCTCTTCAAGGAGAAGCATAAAACAGTTCTTTCAAATTTAAATTATAAAATGAAAATCTTGGAAGTTGAAATTTGGGGCTAAATTGAAAATTG

TGTTTGGTATTTGAGATATCTGTTCATTTAATGTGTAAACATGTTAGTTTTTAGCTTTTCATTTATATATGTATTTATATATTTTGAGTATTATTTTAAA

GCCACAGGTAAATATACTAGAGTGCTAGATGCCTTTTTTCAATCTGATCTTTCATGTAAATTCTGCATTCACCTGTTACTGGTGTCAGGTAAGATTGACA

GCCACACTGATTATTTTATTCTTCCCAGTCTTTGATGACCAAAGAGGAAGTGAGCGCATCATCCCACTGAGATGCTTCCAGAGCCTCCGAGGCTCCTTTC

CTGCCCTCTGTGCATAATTGCCCGTAATGTCCACGAAGGGTTGGTCTAGAAACCCAGAGACGTAATAAGTGAGGAAACAGCTACAAACCCAGAGCATGCC

CAGACAGAGCCTCCTTGCCTCTCCAGAGCAGAGCAGGCCATGGAAAGTCCTCCCTGTGAGTCTTTATGGACAGAGACGGTGGGATCGTCACCACAGTGGG

AAAGGATAAATAGAGTTATTATGAAGCACATTTAAATGTGTCATTTAACTTACTTAGAATTAGAGTGGTTCATTTTATATAGGAAGCCATTATTTTTGTA

TTGTGTAATAAGTAGCTTACTCTGAAGAGAGCCTGGCAAAACAATAAAACATTGTCACTTACTATTGGTTTCTGTGTACCTTGCAAATTTTTCATTTTTA

TTTGGTTAATAGCTTGAAAATATTCTCAATTGGCTTCTTAAAGAAATACCCTGTCAAGCATTTATTAACCAAAAAATAGCCTCTTACAGTAAATAAGAGG

GAACTATGAGAGTGTCTACCCGTGAAGCCCCAAGTGCCCTGGTAATGGACCTGCTCTCCCTCCCTGTGCTGGAAAGCCATTCCGAGGGTGCCTGTGCGTA

CACAGCCAGTCTTGGCTCCTCCCAACTGCACTGTTAAAGCGCAGCCCCGAAGACACTTTCTAGTGATTTTGGTCTGTTGCTTAAATCATTTACTAGATTA

GTTTTAGGGCAACACTTTCCAAATACATAACTTGACTGTTGTGCTTATCAGCTGCCAGAAAGAAACAGGTTATTGTTGGGAAACCTTGCTGTTTTTAAAG

TTTGATTCAATTAAAAGCAATACTTCCAAATAGACAGTGAAAACTTCCCAAAAGAGGAAGAAGCCCAGTGTACTGCCGCACATCTGTAGTCCCAGCTGCT

TGAAGCAGAGGCGGGAAGAGTGCTAGAGCCCAGGAGGTCCCTGCCAGGCCGGGCAACACTGCAAGACACAGTCTCAAAGGCCAAGCAGCCGAAAGGGCTC

TCCTCACAGCCAGCTTTATCACCTCTACGTTCTGGGCCAAACAGTGACATGGGCATTTTGGTTTTCCTAACAACTAACGATGAATGTTCTGAAGGTACAT

TTCATTTTAAATACGGAAAAAACTTTTCATAATTACAGACAAGAAGGAAAAACCCCCGATTTTCCAATAATATAAAGAGCACAGTTGGTCTTCCAAAGGT

GTCCATGTGTGAAGCTACAAGTACTTCGAAATGCACTAAAATTTTGAAGCAAATCTACCTTAGGAACTTTTTTGAAATTGTACTTTTAAAGGTTTAGGCT

TTTGCTTAAATATTCTGAGTTAAATTCTGTACTAGGAAAGATGTTGGATTCTTTCCTTAAATACTAAATAAGTTCCTCATCTTATTTTTAATCAAATGTT

TTATAGAAATGAGTTGAGAAAAGTTGACCATGCACTATTTATAGTACTTTGCCATAACAGGCAATGTTCTAAAACTAAATTTATTTTTGTTTAGTGAACA

TGAGTTTAGATTTTTAAAGTTGGTAATTTATCTCCACTAATATTTTTTTAAAGAAACTGTGAAGAGATTAACAGAATAATTTTATTTCAGATTTTACTAA

TGTAGTGTGTAGCTACAACTTGACATTCAAGTGAAGACTAGACTTCTGTTTTGAAATTTTTCCATCAGGTAGTTTCAGTGGTTTCATTTTAGAAATGTGT

TTGCAGATGTTTGACAAAGGGAATATTACTAAAAAAGAAAAGCAAAAAAAAAAAAAACTTATCAAATGAAGAATTGTTAGAAAAATTTAAATTCCCTGCT

AAAGACATTTTTGTTAGTCTTAGGGGGTAGGTATTTGCTTTCTAGAACTTGTTTTTGTTGATAGTATTTGCTTTCTAGAACTTGTTTTTGTTGATAGCTG

GATGTATGGAACCTGTTTTCTATGCGAGGTGCAAGTCTTGCACTACAGTTGTAAGATATATTATATTGTTTAGGGATCAAGAAAGCAATCTATGCTGAAG

TAACTATAGTATGTAGTTCCTATTGTGAATAATGCTTTGCTTTTGTAATGTATTAATAAAAAGTAACACTTTCTAATG
Translation
 - UNI165 - - UNI2250 - - UNI30259 - MGEKKPEPLDFVKDFQEYLTQQTHHVNMISGSVSGDKEAETLQGA - UNI165 - - UNI3

0259 - - UNI33211 - AGTDGDQNGLDHPSVEVSLDENSGMLVDGFERTFDGKLKCRYCNYASKGTARLIEHIRIHTG - UNI33211 - GEKP

HRCHLCPFASAYERHLEAHMRSHTGEKPYKCELCSFRCSDRSNLSHHRRRKHKMVPIKGTRSSLSSKKMWGVLQKKTSNLGYSRRALINLSPPSMVVQKP

DYLNDFTHEIPNIQTDSYEAMAKTTPTGGLPRDPQELMVDNPLNQLSTLAGQLSSLPPENQNPASPDVDACPDEKPFMIQQPSAQAVVSAVSASIPQSSS

PTSPEPRPSHSQRNYSPVAGPSSEPSAHTSTPSIGNSQPSTPAPTLPVQDPQLLHHCQHCDVYFADNVLYTVHMGCHGYDSPFQCNVCGCKCKDKYDFAC

HFARGQHNQH
Transcript ENSMUST00000121033
Sequence
ACAACAAATATGGCGGCTACAGCTGCGACGCTGACGAACGCTGAGGCGGTGGCGGTGGCGGCGACGGCAGTGAAAAGGGCTGTGGGGATTCCTCGGTGCG

GTTGTCAGGAG - UNI165 - - UNI2250 - - UNI30259 - ATATAACAGACTTTCAACTTAAAGAAAGAAAGAAAAAAAAAAGCACCAAGAT

GGGTGAAAAGAAACCAGAGCCTTTGGACTTTGTAAAAGATTTCCAGGAATACCTGACCCAGCAGACGCATCATGTGAACATGATTTCGGGATCAGTTAGT

GGGGACAAAGAAGCAGAGACTCTTCAGGGAG - UNI165 - - UNI30259 - - UNI33211 - CTGGAACAGATGGCGATCAGAATGGCCTTGA

TCACCCGTCTGTTGAAGTTTCCCTGGATGAAAACTCAGGAATGTTAGTAGACGGGTTTGAGAGGACCTTCGATGGGAAGCTCAAGTGTCGGTACTGCAAC

TATGCCAGCAAAGGAACGGCCAGGCTCATTGAGCACATCAGGATCCACACAG - UNI33211 - CAGGACAGTTGTCCAGCTTGCCACCAGAAAACCA

AAACCCTGCCTCTCCTGATGTAGATGCCTGCCCTGATGAAAAGCCTTTCATGATTCAGCAACCCTCTGCCCAAGCAGTTGTCTCTGCTGTGTCAGCAAGT

ATTCCTCAGAGCTCCTCCCCCACAAGTCCGGAACCGCGGCCATCGCATAGTCAGAGGAACTACAGTCCAGTGGCAGGGCCCAGCAGTGAACCAAGTGCCC

ACACCAGTACTCCCAGCATAGGAAACAGCCAGCCAAGCACTCCAGCTCCAACCCTGCCGGTGCAGGATCCTCAGCTTCTACACCACTGCCAGCACTGTGA

CGTGTACTTTGCAGACAACGTCCTTTACACTGTCCACATGGGGTGCCATGGGTATGACAGCCCCTTTCAGTGTAACGTATGTGGGTGCAAATGTAAAGAC

AAGTACGATTTTGCCTGTCATTTTGCAAGAGGGCAACACAACCAGCACTGAACACAATCAACATTGTTCTCACTTGGTTTGGCCTTTTGGGAGTTTGTAG

TTTGGTTTTTAGTTTGATCATCCCTAATAAGGTATATGCTAATTTAAAATTTATACATTCTAGTCTATAAAATAGAAGTTTGATAGTGAAAAAGGGTTTT

GTTAACTTTTCATAAAAGTCTGGTCAGGGTTATTTATGCATTAGATAGTTAGATGCATTGCTGTCTTTTTCATTTACACCTATGAGAGTTAAAGTACAGT

TGTAATCAGTTTCCTACACTTGTCCATAAGGATTCCCAGGGTTATCTGTACTCCTGATGCTTCAGGATATACATTACAGCTAATGTTCTTTCTGCCATAT

GTCAAAATGGCACACTTCTCATAAAATCTTTTATAACATTTCAGTGTTTATAGACAAACTGCCTTTAAGTTTGCTCCTAATTAAAATACTATTTTCATTC

ACATAACTTAAGTTGAATTAGTTTCATTACAACCAAAACCAGTAGTTATTTCAGTGTAATAAATATTTCTCTTCAAGGAGAAGCATAAAACAGTTCTTTC

AAATTTAAATTATAAAATGAAAATCTTGGAAGTTGAAATTTGGGGCTAAATTGAAAATTGTGTTTGGTATTTGAGATATCTGTTCATTTAATGTGTAAAC

ATGTTAGTTTTTAGCTTTTCATTTATATATGTATTTATATATTTTGAGTATTATTTTAAAGCCACAGGTAAATATACTAGAGTGCTAGATGCCTTTTTTC

AATCTGATCTTTCATGTAAATTCTGCATTCACCTGTTACTGGTGTCAGGTAAGATTGACAGCCACACTGATTATTTTATTCTTCCCAGTCTTTGATGACC

AAAGAGGAAGTGAGCGCATCATCCCACTGAGATGCTTCCAGAGCCTCCGAGGCTCCTTTCCTGCCCTCTGTGCATAATTGCCCGTAATGTCCACGAAGGG

TTGGTCTAGAAACCCAGAGACGTAATAAGTGAGGAAACAGCTACAAACCCAGAGCATGCCCAGACAGAGCCTCCTTGCCTCTCCAGAGCAGAGCAGGCCA

TGGAAAGTCCTCCCTGTGAGTCTTTATGGACAGAGACGGTGGGATCGTCACCACAGTGGGAAAGGATAAATAGAGTTATTATGAAGCACATTTAAATGTG

TCATTTAACTTACTTAGAATTAGAGTGGTTCATTTTATATAGGAAGCCATTATTTTTGTATTGTGTAATAAGTAGCTTACTCTGAAGAGAGCCTGGCAAA

ACAATAAAACATTGTCACTT
Translation
 - UNI165 - - UNI2250 - - UNI30259 - MGEKKPEPLDFVKDFQEYLTQQTHHVNMISGSVSGDKEAETLQGA - UNI165 - - UNI3

0259 - - UNI33211 - AGTDGDQNGLDHPSVEVSLDENSGMLVDGFERTFDGKLKCRYCNYASKGTARLIEHIRIHTA - UNI33211 - AGQL

SSLPPENQNPASPDVDACPDEKPFMIQQPSAQAVVSAVSASIPQSSSPTSPEPRPSHSQRNYSPVAGPSSEPSAHTSTPSIGNSQPSTPAPTLPVQDPQL

LHHCQHCDVYFADNVLYTVHMGCHGYDSPFQCNVCGCKCKDKYDFACHFARGQHNQH

For any suggestions or comments, please send an email to unitrap@crg.es