Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040174 (Alkbh3)
Chromosomal location
Chr 2: 93820707 - 93850964 (-)
Description
alkB, alkylation repair homolog 3 (E. coli) Gene [Source:MGI (curated);Acc:Alkbh3-001]
RefSeq_dna
NM_026944 
RefSeq_peptide
NP_081220.1 
MGI
MGI:1916363 
Uniprot/SWISSPROT
Q8K1E6 
Uniprot/SPTREMBL
A2AKV6 A2AKV7 
Human Ortholog
ENSG00000166199 (ALKBH3)
Omim not available
UniTrap UNI27523
Vector Insertion
Chr 2: 93848750 - 93850839
Public Clones not available
Private Clones OST57619 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36463
Vector Insertion
Chr 2: 93841581 - 93843314
Public Clones IST14983D10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29127
Vector Insertion
Chr 2: 93836550 - 93841581
Public Clones not available
Private Clones OST7712 (lexicon)
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000040005
Sequence
GACGGCTGATTAGGGTCGTGTCGGGACCTCTGCTCAGGGCCCAGCCAG - UNI27523 - GTAGCCATCCCTTGGTCTGAATGGGGAATGAAATCTTC

TGACATCTCAGAACAGAACGCTTTTTCTTCACCATGGAGGACAAGAGACAGCGAGCCCGAGTGCAGGGAGGCTGGGCTACACCTACCAAGAGCCAGTCTG

CTACTCAGCCAG CTTCCCCTGCTAGGAGCCGTCTTTCCCAGACCGCGGGGCCAGCCTGGAGGAGCAAGGAACAGCAGCAATGTGACCGACAATTTGTGT

TCAAAGAACCTCAGCTG GTTGTCCGTGCAGCCCCAGAACCCAGAGTGATTGA CAGGGAGGGTGTGTATGAAATCAGCCTGTCACCTACTGGTGTGTCT

AG - UNI36463 - GGTGTGCTTATATCCTGGCTTTGTGGACTTGAAGGAAGCTGACTGGATCTTGGAGCAGCTTTGTAAGGATGTCCCCTGGAAACA

GAGGATGGGCATCAGAGAGG - UNI36463 - ATGTAACTTATCCGCAACCAAGACTTACAGCATGGTATGGAGAGCTTCCTTACACTTACTCGAGAA

TCACTATGGAACCAAATCCTCAC - UNI29127 - - UNI36463 - TGGCTTCCTGTGCTGTGGACTCTGAAGAGCCGCATTGAAGAGAACACCAG

CCACACCTTCAACTCCTTGCTGTGTAATTTTTACCGGGATGAGAAGGACAGTGTGGACTGGCACAGCGACGATGAACCATCCCTGGGGAGCTGCCCCGTC

ATTGCTTCCCTCAGTTTTGGTGCCACTCGGACTTTTGAGATGAGGAAGAAGCCCCCACCT GAAGAAAATGGAGACTATACATATGTGGAGAGAGTGAAG

ATACCATTGGATCACGGGACCTTGCTAATCATGGAAGGAGCCACACAAGCCGACTGGCAG CACCGAGTGCCCAAGGAATACCACTCCAGACAACCGAGA

GTAAACTTAACCTTTCGGACCGTTTATCCAGACCCAAGAGGAGCCCCTCGGTGACACTTCTACAGAGTTACCACTGAGGGGAGGGCTATGCACCTAACAG

CCCCTCCCCATCTCCCGCAAGCACTTCCGTGATGTGGCTGTTCAGAAAGCGTGGTGTTTGCTTCTCAGGTTCTACTCCTCCTGAATGAGAGCTGCCAGCA

CGTCACCTTGTCAACATGTCTACTACAGGAACACTTACTTTGAGACAAATCTCTAAATCAAGGTTATCATTAAGCAAATTAAAAATTGCTCTGGCTGTAC

TC
Translation
 - UNI27523 - MEDKRQRARVQGGWATPTKSQSATQPA ASPARSRLSQTAGPAWRSKEQQQCDRQFVFKEPQL VVRAAPEPRVID DREGVYEIS

LSPTGVSR - UNI36463 - RVCLYPGFVDLKEADWILEQLCKDVPWKQRMGIRED - UNI36463 - DVTYPQPRLTAWYGELPYTYSRITMEPN

PH - UNI29127 - - UNI36463 - WLPVLWTLKSRIEENTSHTFNSLLCNFYRDEKDSVDWHSDDEPSLGSCPVIASLSFGATRTFEMRKKPPP 

EENGDYTYVERVKIPLDHGTLLIMEGATQADWQ HRVPKEYHSRQPRVNLTFRTVYPDPRGAPR
Transcript ENSMUST00000111240
Sequence
GGAACTACGCGCAACGGAGGCCTGTGGTTGGACGTTGCAGGAGTTGGTGCCTCACTCTGAAGGTTCCCCGGCGTCCAGACGGCTGATTAGGGTCGTGTCG

GGACCTCTGCTCAGGGCCCAGCCAG - UNI27523 - GTAGCCATCCCTTGGTCTGAATGGGGAATGAAATCTTCTGACATCTCAGAACAGAACGCTT

TTTCTTCACCATGGAGGACAAGAGACAGCGAGCCCGAGTGCAGGGAGGCTGGGCTACACCTACCAAGAGCCAGTCTGCTACTCAGCCAGGCAAGAACCTG

CAGAGACT CCGTCTTTCCCAGACCGCGGGGCCAGCCTGGAGGAGCAAGGAACAGCAGCAATGTGACCGACAATTTGTGTTCAAAGAACCTCAGCTG GT

TGTCCGTGCAGCCCCAGAACCCAGAGTGATTGA CAGGGAGGGTGTGTATGAAATCAGCCTGTCACCTACTGGTGTGTCTAG - UNI36463 - GGTG

TGCTTATATCCTGGCTTTGTGGACTTGAAGGAAGCTGACTGGATCTTGGAGCAGCTTTGTAAGGATGTCCCCTGGAAACAGAGGATGGGCATCAGAGAGG

 - UNI36463 - ATGTAACTTATCCGCAACCAAGACTTACAGCATGGTATGGAGAGCTTCCTTACACTTACTCGAGAATCACTATGGAACCAAATCCT

CAC - UNI29127 - - UNI36463 - TGGCTTCCTGTGCTGTGGACTCTGAAGAGCCGCATTGAAGAGAACACCAGCCACACCTTCAACTCCTTGC

TGTGTAATTTTTACCGGGATGAGAAGGACAGTGTGGACTGGCACAGCGACGATGAACCATCCCTGGGGAGCTGCCCCGTCATTGCTTCCCTCAGTTTTGG

TGCCACTCGGACTTTTGAGATGAGGAAGAAGCCCCCACCT GAAGAAAATGGAGACTATACATATGTGGAGAGAGTGAAGATACCATTGGATCACGGGAC

CTTGCTAATCATGGAAGGAGCCACACAAGCCGACTGGCAG CACCGAGTGCCCAAGGAATACCACTCCAGACAACCGAGAGTAAACTTAACCTTTCGGAC

CGTTTATCCAGACCCAAGAGGAGCCCCTCGGTGACACTTCTACAGAGTTACCACTGAGGGGAGGGCTATGCACCTAACAGCCCCTCCCCATCTCCCGCAA

GCACTTCCGTGATGTGGCTGTTCAGAAAGCGTGGTGTTTGCTTCTCAGGTTCTACTCCTCCTGAATGAGAGCTGCCAGCACGTCACCTTGTCAACATGTC

TACTACAGGAACACTTACTTTGAGACAAATCTCTAAATCAAGGTTATCATTAAGCAAATTAAAAATTGCTCTGGCTGTACTCACAGATGATTTGATCCAA

AAGCTTTTTGCCTCCTGCTCTGCCCCCTTTAATTTGAAGAAATACAAATGGCCTTGTGCCTCTGGGGAA
Translation
 - UNI27523 - MEDKRQRARVQGGWATPTKSQSATQPGKNLQRL LRLSQTAGPAWRSKEQQQCDRQFVFKEPQL VVRAAPEPRVID DREGVYEI

SLSPTGVSR - UNI36463 - RVCLYPGFVDLKEADWILEQLCKDVPWKQRMGIRED - UNI36463 - DVTYPQPRLTAWYGELPYTYSRITMEP

NPH - UNI29127 - - UNI36463 - WLPVLWTLKSRIEENTSHTFNSLLCNFYRDEKDSVDWHSDDEPSLGSCPVIASLSFGATRTFEMRKKPPP

 EENGDYTYVERVKIPLDHGTLLIMEGATQADWQ HRVPKEYHSRQPRVNLTFRTVYPDPRGAPR

For any suggestions or comments, please send an email to unitrap@crg.es