Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040183 (Ankrd6)
Chromosomal location
Chr 4: 32891010 - 33037816 (-)
Description
ankyrin repeat domain 6 Gene [Source:MGI (curated);Acc:Ankrd6-002]
RefSeq_dna
NM_001012450 NM_001012451 NM_080471 
RefSeq_peptide
NP_001012453.1 NP_001012454.1 NP_536719.2 
UniGene
Mm.214766 
MGI
MGI:2154278 
Uniprot/SWISSPROT
Q69ZU8 
Uniprot/SPTREMBL
A2ANY8 Q6P1A8 
Human Ortholog
ENSG00000135299 (ANKRD6)
Omim not available
UniTrap UNI30861
Vector Insertion
Chr 4: 33010275 - 33037802
Public Clones IST14635H4 (tigm) IST14811G10 (tigm) IST12404A9 (tigm) IST12934E12 (tigm)
IST14570H7 (tigm) IST13515G10 (tigm) IST10091H11 (tigm) IST12443C12 (tigm)
IST13513B11 (tigm) IST12503H12 (tigm) IST14654F5 (tigm) IST14158A8 (tigm)
IST14934G1 (tigm) IST13894C5 (tigm) IST14769H8 (tigm) IST14990F6 (tigm)
IST14635E3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29946
Vector Insertion
Chr 4: 32961181 - 33010481
Public Clones (sanger) D072H04 (ggtc) 5SE287C05 (ggtc) D183F08 (ggtc) IST13269D7 (tigm)
IST10834G12 (tigm) IST14555D9 (tigm) IST14888C3 (tigm) IST11608C6 (tigm)
IST13974A12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22852
Vector Insertion
Chr 4: 32923409 - 32947296
Public Clones not available
Private Clones OST282903 (lexicon) OST266559 (lexicon) OST56148 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108166
Sequence
CATGAGCCAGCAGGATGCGGTCGCTGCGCTTTCAGAACGCCTGCTCATAGCTGCGTACAAAGGCCAAACAGAGAATGTGGTTCAGCTCATCAACAAGGGT

GCCAAGGTAGCCGTTACCAAG - UNI22852 - CATGGCCGGACCCCCTTGCACCTCGCTGCCAATAAGGGTCATCTTTCTGTGGTGCAGATTTTGCT

GAAGGCTGGCTGTGACCTCGATGTGCAAGATGAT GGGGACCAGACAGCCTTGCACCGGGCCACTGTGGTGGGAAACACCGAGATCCTCACAGCGCTTAT

CCGGGAGGGGTGTGCCCTGGACAGACAGGACAAG GCAGGGAACACAGCTCTGCACCTGGCCTGCCAGAATAGTCACTCCCAGAGCACTCGCATCCTCCT

GCTGGGCGGCTCCCGGGCTGACCTCAAAAACAAC GCAGGGGACACCTGTCTGCACGTGGCTGCGCGGTATAACCACTTGTCCGTCGTCAGACTCCTCCT

CAATGCTTTCTGCTCTGTCCATGAAAAGAACCAG GCTGGAGACACGGCCCTCCATGTGGCTGCTGCCCTAAATCACAAGAAGGTAGTTAAAGTCCTGCT

GGAAGCTGGTGCTGACACAACCATTGTGAACAAT ATCTTGCGCTTCAGTCGTGGGCGAAGCCTGAGGAAAAGGAGAGAGAGGCTCAAGGAAGAGAGGAG

GGCCCAGTCTGTGCCCCGAGATGAGGTGGCACAGAGCAAG GGAAGTGTCTCAGCAGGAGATACCCCCAGCAGTGAACAAGCAGTACCCCAAAAAGAGGA

AGCTAGAAGAGATTGTCCACCAGCTTCCCAGGAGCCAAGAAAGGATGAGAGGAGGAGAAAGTCGAGGCCAGAG GTGTCAGCGTTATCTGACCCCACCCC

AGCCGCAGACCAACAGCCTGGACACCAAAAGAACCTGCACAGTCATCACCACCCCAAAAAGAAGAGCAGACATCGGTGTTGGTCCCCACCTCCACCCCAC

GGGTTCAGGGCGTACCAGCTATACACGCTGTACCGGGGCGAGGATGGAAAAGTGATGCAG GCACCAATAAAAGGTTGTCGCTGTGAACCTCTAATCAAC

AAGCTGGAGAACCAGTTGGAGGCGACTGTGGAGGAAATCAGAGCTGAGTTAGGCTCGGTGCAGGATAAAGTGAACGCGAAGCTGGGCCAGATGGAGAGCA

AAACCCAGCACCAA ATGTGCGTTTTGGACAAACTGATGGTGGAACGGCTGTCCGCGGAGAGAACAGAATGCATGAATCGCCTGCAACAGCATGCAGCTG

CTGAGAAGCAGGAGGGAGAGAAACGTCAG ATGTCTTTGGTAGATGAACTAAAAGCCTGGTGCATGTTGAAGATCCAGAGTCTGGAGCTAAGACTCTCTG

GAGAGTCTCGGACCTTCAGAGCTAAATCCACACCACCTCCGTCTGACTCCACTCCAG TGGTAGCTGCAGGGCCAGGAGCAGCTTCCGACAGCTCCTCTC

AGGTTGTGAGGCCCAAGGATAAGGCGCTCAATGCCTCGGCTGCCCACAGCCACCAGCAGGAGCTGCCTCCCTCTGACTGTACAGGGTCTGGGTTAAGGAA

GATCAAGGCCCCGGGTGCTTCCAGGTGTGATCAGCAGACTGGATCCTGTGTCAACCGAGGCACTCAGACCAAGAAGTCTGGGAGAAGTGGGCAGACCAAG

CATCGAGGCCAGCAGCCCACTGCCAGCAGCCCCAGTGGGCAGCAGCCATCAGCAGCAAGCAGTGATGTGCGAGACGCCTCACAAGCCCTGGAGCTAACTC

AGTATTTTTTTGAGGCCGTTTCTGCACAGATGGAAAAGTGGTATGAACGGAAAATTGAAGAAGCACGGAGCCAAGCAAGTCAGAAAGCTCAGCAGGATGA

GGCCACATTGAAGGAACACATCAGAAGTCTGGAGGAGGAGCTTGCCAGGCTGCGGACAAAGGTGCAGAAGTAAAAGCCAGACCCTCAGCTGGACCCAACA

GGGTTTCCGGCTTGATAACAGCCAAGTAACGGTGTCCCAGGAGTTGGTTGTCACGCCCAAGGTGGACTTGCCTTTTAGAAAGTCACGAATGTGTTGCGGA

CACATATTTCCTGTGCTCTGAAATTACAAGGCCTTCACTGGTTAAAATGAATCCTGGCAATATGTTCACAAAAAGCAAGCTGCACCCAGATGAGGTGTGT

ACCCAAGTCTGCGATTCAGTGACATGAACTATGTCGGCAGCAAAGCAGATTACTCTGCGAGCCCAGTAGTCATTCACAGCTGCTGTGACTAGACAGTCCT

TCTAACGGAGCTGGGACGCGGATGCCGGAAGCCCCTTTTCTCCCAT
Translation
MSQQDAVAALSERLLIAAYKGQTENVVQLINKGAKVAVTK - UNI22852 - HGRTPLHLAANKGHLSVVQILLKAGCDLDVQDD GDQTALHRATVV

GNTEILTALIREGCALDRQDK AGNTALHLACQNSHSQSTRILLLGGSRADLKNN AGDTCLHVAARYNHLSVVRLLLNAFCSVHEKNQ AGDTALHVAA

ALNHKKVVKVLLEAGADTTIVNN ILRFSRGRSLRKRRERLKEERRAQSVPRDEVAQSK GSVSAGDTPSSEQAVPQKEEARRDCPPASQEPRKDERRRK

SRPE VSALSDPTPAADQQPGHQKNLHSHHHPKKKSRHRCWSPPPPHGFRAYQLYTLYRGEDGKVMQ APIKGCRCEPLINKLENQLEATVEEIRAELGS

VQDKVNAKLGQMESKTQHQ MCVLDKLMVERLSAERTECMNRLQQHAAAEKQEGEKRQ MSLVDELKAWCMLKIQSLELRLSGESRTFRAKSTPPPSDST

PV VVAAGPGAASDSSSQVVRPKDKALNASAAHSHQQELPPSDCTGSGLRKIKAPGASRCDQQTGSCVNRGTQTKKSGRSGQTKHRGQQPTASSPSGQQP

SAASSDVRDASQALELTQYFFEAVSAQMEKWYERKIEEARSQASQKAQQDEATLKEHIRSLEEELARLRTKVQK
Transcript ENSMUST00000084748
Sequence
CACGCGCGGTGGAGCGTGGGGCGAGCGGCTGCGGGCAAGGAGCGCAGCGGCCCGCGAGCTCCGTGCGGAGCGGCCGGCCGGCGCGGGAGCGAAAG - UN

I29946 - - UNI30861 - GACCTGAAGATGGAGTAGTGAGAAAGGCATCCCTCAGGATTCCGAGCACCTTTCGCTGTGGACTCCAGCCCCACCCGA

GGCTGCATGTGGAGCTGAGGAAACTGACCCACCGCTTGCTTTCCTGGGAGCCCCTTTCTCTCCTAATTCATGAGCCAGCAGGATGCGGTCGCTGCGCTTT

CAGAACGCCTGCTCATAGCTGCGTACAAAGGCCAAACAGAGAATGTGGTTCAGCTCATCAACAAGGGTGCCAAGGTAGCCGTTACCAAG - UNI22852

 - CATGGCCGGACCCCCTTGCACCTCGCTGCCAATAAGGGTCATCTTTCTGTGGTGCAGATTTTGCTGAAGGCTGGCTGTGACCTCGATGTGCAAGATG

AT GGGGACCAGACAGCCTTGCACCGGGCCACTGTGGTGGGAAACACCGAGATCCTCACAGCGCTTATCCGGGAGGGGTGTGCCCTGGACAGACAGGACA

AG GATGGGAATACAGCCCTGCATGAAGCCGCCTGGCACGGATTCAGCCAGTCAGCCAAGCTGCTCGTTAAAGCCGGAGCCAATGTGCTTGCCAGAAACA

AG GCAGGGAACACAGCTCTGCACCTGGCCTGCCAGAATAGTCACTCCCAGAGCACTCGCATCCTCCTGCTGGGCGGCTCCCGGGCTGACCTCAAAAACA

AC GCAGGGGACACCTGTCTGCACGTGGCTGCGCGGTATAACCACTTGTCCGTCGTCAGACTCCTCCTCAATGCTTTCTGCTCTGTCCATGAAAAGAACC

AG GCTGGAGACACGGCCCTCCATGTGGCTGCTGCCCTAAATCACAAGAAGGTAGTTAAAGTCCTGCTGGAAGCTGGTGCTGACACAACCATTGTGAACA

AT GCAGGCCAGACCCCGCTGGAGACTGCCCGCTACCACAATAATCCTGAAGTCGCACTACTCCTCACCAAGGCTCCCCAG GGAAGTGTCTCAGCAGGA

GATACCCCCAGCAGTGAACAAGCAGTACCCCAAAAAGAGGAAGCTAGAAGAGATTGTCCACCAGCTTCCCAGGAGCCAAGAAAGGATGAGAGGAGGAGAA

AGTCGAGGCCAGAG GTGTCAGCGTTATCTGACCCCACCCCAGCCGCAGACCAACAGCCTGGACACCAAAAGAACCTGCACAGTCATCACCACCCCAAAA

AGAAGAGCAGACATCGGTGTTGGTCCCCACCTCCACCCCACGGGTTCAGGGCGTACCAGCTATACACGCTGTACCGGGGCGAGGATGGAAAAGTGATGCA

G GCACCAATAAAAGGTTGTCGCTGTGAACCTCTAATCAACAAGCTGGAGAACCAGTTGGAGGCGACTGTGGAGGAAATCAGAGCTGAGTTAGGCTCGGT

GCAGGATAAAGTGAACGCGAAGCTGGGCCAGATGGAGAGCAAAACCCAGCACCAA ATGTGCGTTTTGGACAAACTGATGGTGGAACGGCTGTCCGCGGA

GAGAACAGAATGCATGAATCGCCTGCAACAGCATGCAGCTGCTGAGAAGCAGGAGGGAGAGAAACGTCAG ATGTCTTTGGTAGATGAACTAAAAGCCTG

GTGCATGTTGAAGATCCAGAGTCTGGAGCTAAGACTCTCTGGAGAGTCTCGGACCTTCAGAGCTAAATCCACACCACCTCCGTCTGACTCCACTCCAG C

TGTAGACCAACCAGTGGTAGCTGCAGGGCCAGGAGCAGCTTCCGACAGCTCCTCTCAGGTTGTGAGGCCCAAGGATAAGGCGCTCAATGCCTCGGCTGCC

CACAGCCACCAGCAGGAGCTGCCTCCCTCTGACTGTACAGGGTCTGGGTTAAGGAAGATCAAGGCCCCGGGTGCTTCCAGGTGTGATCAGCAGACTGGAT

CCTGTGTCAACCGAGGCACTCAGACCAAGAAGTCTGGGAGAAGTGGGCAGACCAAGCATCGAGGCCAGCAGCCCACTGCCAGCAGCCCCAGTGGGCAGCA

GCCATCAGCAGCAAGCAGTGATGTGCGAGACGCCTCACAAGCCCTGGAGCTAACTCAGTATTTTTTTGAGGCCGTTTCTGCACAGATGGAAAAGTGGTAT

GAACGGAAAATTGAAGAAGCACGGAGCCAAGCAAGTCAGAAAGCTCAGCAGGATGAGGCCACATTGAAGGAACACATCAGAAGTCTGGAGGAGGAGCTTG

CCAGGCTGCGGACAAAGGTGCAGAAGTAAAAGCCAGACCCTCAGCTGGACCCAACAGGGTTTCCGGCTTGATAACAGCCAAGTAACGGTGTCCCAGGAGT

TGGTTGTCACGCCCAAGGTGGACTTGCCTTTTAGAAAGTCACGAATGTGTTGCGGACACATATTTCCTGTGCTCTGAAATTACAAGGCCTTCACTGGTTA

AAATGAATCCTGGCAATATGTTCACAAAAAGCAAGCTGCACCCAGATGAGGTGTGTACCCAAGTCTGCGATTCAGTGACATGAACTATGTCGGCAGCAAA

GCAGATTACTCTGCGAGCCCAGTAGTCATTCACAGCTGCTGTGACTAGACAGTCCTTCTAACGGAGCTGGGACGCGGATGCCGGAAGCCCCTTTTCTCCC

ATGTGACTCAAGATGCTCATCTTTTAAAGGGGTGAAAAGCGCTCAGGTTTTGAGGAAATACATTGTAATGATCTCAGTGTCCAGTATGTCTTAAAGTAAT

GTTAAGGGTCATGTAAAGAAGGAGTAATTGCTGACTGTCAAACTCGAAAAGTTTAAAATATTGGTCAGTTACTGTGGTTTTAGCCAAATAACTGAGCAGA

CTAATGGAAAAAATCCACCAAACAACTCCAGCTAGTTACCTTAGCTTGATTGCCTTTCTAACGTCAAGACTTTTGCTGGTTTGTAAATAAGGCAGAATCA

TGAAAGTTTAATTTTGAGTTGACTCCTCACTGAAGAACACCAAGCCATCAGAAGGCTTTACTTGTTCGCGGAGTAAGATGTAACAGACTGAGGTGGTGAC

GATATCTGGGTTGGGACCTAGGATTTGTCCTCGGATCCTTTGGAACACAGAACATGGATTATGTCCGTCTCCATGATCCACATACACATAGGAACTTCTG

TTTCTCTAAGCCTAAGGACCTCATAAATCCTGTCCATGAATTGTGACTAAAATGCTGTTCATTGAGCCAAAGAGAAGTGACCTTTGTGAAATAGTATGCA

TTTATCCCTTTGTCAAGCCAAGTTCTTCCTTTTTCTTATAGTGACACTCCATGGATGTAGACATTCCTGGAAACATACAGGGTAGATATATGAGTACAGA

ATCTAGTGAGGCCAGTTATTTCATGGGACTGACCCGTCCTCAGCCTCTTGGGAGGTGCAGATTTTTCCCATTCTCCTTCACTGGAGTCCTGTCCTCAGCT

CACTTGCCCCATCCCTGCTATGACACTCCCTGGACAAAATGTCACTGGACCTGCCTAATACTAAGTAAGAGATGAAACCCCGAGTTCAGCAAGTTATGCT

CCAAGCAGGAGTTATTTTCACTATTAGAATACTTATTACCTCAAGATACCCTTGACAAGAAATGCAGACATCAACTGTAACTGAACATCAAATCTAGACC

ACAGACTACCTTGGTGGCAGTACTTTGATGCTATACCTCCTACCCATCAGAAGCAGGCAGCTTATCACTGTGAATGGATGTTTTTGTCAAGTCATTAAGC

ATAAAGCCAGGCTATTGAATAAGGCCAGTCAGCCCCTTACCCACAGGGTTGACTTCTAAGGAAGTGGTGGTTGGCTTGTTTTGGAAGGCTCTACTGTGTA

CTCTAGACTGTCTCAGCCACCTGAGTTCTGGGATTAAAGGAGTGAGCATGGCTAATCCTGTGTTGTTTGTAACACCCGTCTTAGGTTTGTTGCAATTGTA

AAGCACTGAAGATCAGCTGTGTCTTTTCCCCTTGTGCTATGTGCAAAAACAAGCAAATATCCCAGCTGTACTTTTACAGATAACTGTTTATATCACATAC

TCTCACATAGATCATGCTTCAAACTGAGGCCTAGGAAGCATCAACAGCTGTGGAGAAACATGTTATAAAACAGTAATGTTGTATATTATCAATGTCCTTT

TTAAAAACAAGTAATTGTTAGCACATCCCTTAGACTGTATTCTGAGTATCTGTGATGGGGTGAAAGTGTTAGTCTAGCATCGCTTTTTATTTGAGGAGTC

CGGAATATAGGTTTTTCATGTTTAGATTTGTGTGTGCAAGGCATGTTGTCTGATTTTATCACATGGAACTTGTGTCTCCTATATGCATTAAATGTTGTTT

TCAGTTC
Translation
 - UNI29946 - - UNI30861 - MSQQDAVAALSERLLIAAYKGQTENVVQLINKGAKVAVTK - UNI22852 - HGRTPLHLAANKGHLSVVQ

ILLKAGCDLDVQDD GDQTALHRATVVGNTEILTALIREGCALDRQDK DGNTALHEAAWHGFSQSAKLLVKAGANVLARNK AGNTALHLACQNSHSQS

TRILLLGGSRADLKNN AGDTCLHVAARYNHLSVVRLLLNAFCSVHEKNQ AGDTALHVAAALNHKKVVKVLLEAGADTTIVNN AGQTPLETARYHNNP

EVALLLTKAPQ GSVSAGDTPSSEQAVPQKEEARRDCPPASQEPRKDERRRKSRPE VSALSDPTPAADQQPGHQKNLHSHHHPKKKSRHRCWSPPPPHG

FRAYQLYTLYRGEDGKVMQ APIKGCRCEPLINKLENQLEATVEEIRAELGSVQDKVNAKLGQMESKTQHQ MCVLDKLMVERLSAERTECMNRLQQHAA

AEKQEGEKRQ MSLVDELKAWCMLKIQSLELRLSGESRTFRAKSTPPPSDSTPA AVDQPVVAAGPGAASDSSSQVVRPKDKALNASAAHSHQQELPPSD

CTGSGLRKIKAPGASRCDQQTGSCVNRGTQTKKSGRSGQTKHRGQQPTASSPSGQQPSAASSDVRDASQALELTQYFFEAVSAQMEKWYERKIEEARSQA

SQKAQQDEATLKEHIRSLEEELARLRTKVQK
Transcript ENSMUST00000108167
Sequence
CTGCTGTAGTGCCTTTGTGCTCGGCTGTCCCTTGTTCCCGCAGAGGCTAGCGAGGTCGGGAAGAACCCTCCATTGTGAATCCATTGTGGTCTGAGACTGG

ACGGAAGGTTCGGCCAGCCTGTGTGATTAGAACTGCGTCTTGGGAGTGCCTTTCCTGGATGTGGACAGAGACTCTTGACAGGGTTTGAAGTGAAAATGAG

AACTA - UNI29946 - - UNI30861 - CTGCTGAACACTTGATGCCTAGGTTGTAGCCTGTGTAACACTTCCTGTCACGGGGTGGTGGGAGGCCA

GTGGAAGAGAGACTTCCATACAAGAATCTTATTCTGGAGAGCGGCCTATGGACTTTCCCACGGATGAGTCCTGCAGCTCTTGAGAGCATCCAGGAG - U

NI29946 - GACCTGAAGATGGAGTAGTGAGAAAGGCATCCCTCAGGATTCCGAGCACCTTTCGCTGTGGACTCCAGCCCCACCCGAGGCTGCATGTGG

AGCTGAGGAAACTGACCCACCGCTTGCTTTCCTGGGAGCCCCTTTCTCTCCTAATTCATGAGCCAGCAGGATGCGGTCGCTGCGCTTTCAGAACGCCTGC

TCATAGCTGCGTACAAAGGCCAAACAGAGAATGTGGTTCAGCTCATCAACAAGGGTGCCAAGGTAGCCGTTACCAAG - UNI22852 - CATGGCCGG

ACCCCCTTGCACCTCGCTGCCAATAAGGGTCATCTTTCTGTGGTGCAGATTTTGCTGAAGGCTGGCTGTGACCTCGATGTGCAAGATGAT GGGGACCAG

ACAGCCTTGCACCGGGCCACTGTGGTGGGAAACACCGAGATCCTCACAGCGCTTATCCGGGAGGGGTGTGCCCTGGACAGACAGGACAAG GCAGGGAAC

ACAGCTCTGCACCTGGCCTGCCAGAATAGTCACTCCCAGAGCACTCGCATCCTCCTGCTGGGCGGCTCCCGGGCTGACCTCAAAAACAAC GCAGGGGAC

ACCTGTCTGCACGTGGCTGCGCGGTATAACCACTTGTCCGTCGTCAGACTCCTCCTCAATGCTTTCTGCTCTGTCCATGAAAAGAACCAG GCTGGAGAC

ACGGCCCTCCATGTGGCTGCTGCCCTAAATCACAAGAAGGTAGTTAAAGTCCTGCTGGAAGCTGGTGCTGACACAACCATTGTGAACAAT ATCTTGCGC

TTCAGTCGTGGGCGAAGCCTGAGGAAAAGGAGAGAGAGGCTCAAGGAAGAGAGGAGGGCCCAGTCTGTGCCCCGAGATGAGGTGGCACAGAGCAAG GGA

AGTGTCTCAGCAGGAGATACCCCCAGCAGTGAACAAGCAGTACCCCAAAAAGAGGAAGCTAGAAGAGATTGTCCACCAGCTTCCCAGGAGCCAAGAAAGG

ATGAGAGGAGGAGAAAGTCGAGGCCAGAG GTGTCAGCGTTATCTGACCCCACCCCAGCCGCAGACCAACAGCCTGGACACCAAAAGAACCTGCACAGTC

ATCACCACCCCAAAAAGAAGAGCAGACATCGGTGTTGGTCCCCACCTCCACCCCACGGGTTCAGGGCGTACCAGCTATACACGCTGTACCGGGGCGAGGA

TGGAAAAGTGATGCAG GCACCAATAAAAGGTTGTCGCTGTGAACCTCTAATCAACAAGCTGGAGAACCAGTTGGAGGCGACTGTGGAGGAAATCAGAGC

TGAGTTAGGCTCGGTGCAGGATAAAGTGAACGCGAAGCTGGGCCAGATGGAGAGCAAAACCCAGCACCAA ATGTGCGTTTTGGACAAACTGATGGTGGA

ACGGCTGTCCGCGGAGAGAACAGAATGCATGAATCGCCTGCAACAGCATGCAGCTGCTGAGAAGCAGGAGGGAGAGAAACGTCAG ATGTCTTTGGTAGA

TGAACTAAAAGCCTGGTGCATGTTGAAGATCCAGAGTCTGGAGCTAAGACTCTCTGGAGAGTCTCGGACCTTCAGAGCTAAATCCACACCACCTCCGTCT

GACTCCACTCCAG TGGTAGCTGCAGGGCCAGGAGCAGCTTCCGACAGCTCCTCTCAGGTTGTGAGGCCCAAGGATAAGGCGCTCAATGCCTCGGCTGCC

CACAGCCACCAGCAGGAGCTGCCTCCCTCTGACTGTACAGGGTCTGGGTTAAGGAAGATCAAGGCCCCGGGTGCTTCCAGGTGTGATCAGCAGACTGGAT

CCTGTGTCAACCGAGGCACTCAGACCAAGAAGTCTGGGAGAAGTGGGCAGACCAAGCATCGAGGCCAGCAGCCCACTGCCAGCAGCCCCAGTGGGCAGCA

GCCATCAGCAGCAAGCAGTGATGTGCGAGACGCCTCACAAGCCCTGGAGCTAACTCAGTATTTTTTTGAGGCCGTTTCTGCACAGATGGAAAAGTGGTAT

GAACGGAAAATTGAAGAAGCACGGAGCCAAGCAAGTCAGAAAGCTCAGCAGGATGAGGCCACATTGAAGGAACACATCAGAAGTCTGGAGGAGGAGCTTG

CCAGGCTGCGGACAAAGGTGCAGAAGTAA
Translation
 - UNI29946 - - UNI30861 -  - UNI29946 - MSQQDAVAALSERLLIAAYKGQTENVVQLINKGAKVAVTK - UNI22852 - HGRTP

LHLAANKGHLSVVQILLKAGCDLDVQDD GDQTALHRATVVGNTEILTALIREGCALDRQDK AGNTALHLACQNSHSQSTRILLLGGSRADLKNN AGD

TCLHVAARYNHLSVVRLLLNAFCSVHEKNQ AGDTALHVAAALNHKKVVKVLLEAGADTTIVNN ILRFSRGRSLRKRRERLKEERRAQSVPRDEVAQSK

 GSVSAGDTPSSEQAVPQKEEARRDCPPASQEPRKDERRRKSRPE VSALSDPTPAADQQPGHQKNLHSHHHPKKKSRHRCWSPPPPHGFRAYQLYTLYR

GEDGKVMQ APIKGCRCEPLINKLENQLEATVEEIRAELGSVQDKVNAKLGQMESKTQHQ MCVLDKLMVERLSAERTECMNRLQQHAAAEKQEGEKRQ 

MSLVDELKAWCMLKIQSLELRLSGESRTFRAKSTPPPSDSTPV VVAAGPGAASDSSSQVVRPKDKALNASAAHSHQQELPPSDCTGSGLRKIKAPGASR

CDQQTGSCVNRGTQTKKSGRSGQTKHRGQQPTASSPSGQQPSAASSDVRDASQALELTQYFFEAVSAQMEKWYERKIEEARSQASQKAQQDEATLKEHIR

SLEEELARLRTKVQK
Transcript ENSMUST00000084749
Sequence
CTGCTGTAGTGCCTTTGTGCTCGGCTGTCCCTTGTTCCCGCAGAGGCTAGCGAGGTCGGGAAGAACCCTCCATTGTGAATCCATTGTGGTCTGAGACTGG

ACGGAAGGTTCGGCCAGCCTGTGTGATTAGAACTGCGTCTTGGGAGTGCCTTTCCTGGATGTGGACAGAGACTCTTGACAGGGTTTGAAGTGAAAATGAG

AACTAGTAG - UNI29946 - GACCTGAAGATGGAGTAGTGAGAAAGGCATCCCTCAGGATTCCGAGCACCTTTCGCTGTGGACTCCAGCCCCACCCG

AGGCTGCATGTGGAGCTGAGGAAACTGACCCACCGCTTGCTTTCCTGGGAGCCCCTTTCTCTCCTAATTCATGAGCCAGCAGGATGCGGTCGCTGCGCTT

TCAGAACGCCTGCTCATAGCTGCGTACAAAGGCCAAACAGAGAATGTGGTTCAGCTCATCAACAAGGGTGCCAAGGTAGCCGTTACCAAG - UNI2285

2 - CATGGCCGGACCCCCTTGCACCTCGCTGCCAATAAGGGTCATCTTTCTGTGGTGCAGATTTTGCTGAAGGCTGGCTGTGACCTCGATGTGCAAGAT

GAT GGGGACCAGACAGCCTTGCACCGGGCCACTGTGGTGGGAAACACCGAGATCCTCACAGCGCTTATCCGGGAGGGGTGTGCCCTGGACAGACAGGAC

AAG GATGGGAATACAGCCCTGCATGAAGCCGCCTGGCACGGATTCAGCCAGTCAGCCAAGCTGCTCGTTAAAGCCGGAGCCAATGTGCTTGCCAGAAAC

AAG GCAGGGAACACAGCTCTGCACCTGGCCTGCCAGAATAGTCACTCCCAGAGCACTCGCATCCTCCTGCTGGGCGGCTCCCGGGCTGACCTCAAAAAC

AAC GCAGGGGACACCTGTCTGCACGTGGCTGCGCGGTATAACCACTTGTCCGTCGTCAGACTCCTCCTCAATGCTTTCTGCTCTGTCCATGAAAAGAAC

CAG GCTGGAGACACGGCCCTCCATGTGGCTGCTGCCCTAAATCACAAGAAGGTAGTTAAAGTCCTGCTGGAAGCTGGTGCTGACACAACCATTGTGAAC

AAT GCAGGCCAGACCCCGCTGGAGACTGCCCGCTACCACAATAATCCTGAAGTCGCACTACTCCTCACCAAGGCTCCCCAG ATCTTGCGCTTCAGTCG

TGGGCGAAGCCTGAGGAAAAGGAGAGAGAGGCTCAAGGAAGAGAGGAGGGCCCAGTCTGTGCCCCGAGATGAGGTGGCACAGAGCAAG GGAAGTGTCTC

AGCAGGAGATACCCCCAGCAGTGAACAAGCAGTACCCCAAAAAGAGGAAGCTAGAAGAGATTGTCCACCAGCTTCCCAGGAGCCAAGAAAGGATGAGAGG

AGGAGAAAGTCGAGGCCAGAG GTGTCAGCGTTATCTGACCCCACCCCAGCCGCAGACCAACAGCCTGGACACCAAAAGAACCTGCACAGTCATCACCAC

CCCAAAAAGAAGAGCAGACATCGGTGTTGGTCCCCACCTCCACCCCACGGGTTCAGGGCGTACCAGCTATACACGCTGTACCGGGGCGAGGATGGAAAAG

TGATGCAG GCACCAATAAAAGGTTGTCGCTGTGAACCTCTAATCAACAAGCTGGAGAACCAGTTGGAGGCGACTGTGGAGGAAATCAGAGCTGAGTTAG

GCTCGGTGCAGGATAAAGTGAACGCGAAGCTGGGCCAGATGGAGAGCAAAACCCAGCACCAA ATGTGCGTTTTGGACAAACTGATGGTGGAACGGCTGT

CCGCGGAGAGAACAGAATGCATGAATCGCCTGCAACAGCATGCAGCTGCTGAGAAGCAGGAGGGAGAGAAACGTCAG ATGTCTTTGGTAGATGAACTAA

AAGCCTGGTGCATGTTGAAGATCCAGAGTCTGGAGCTAAGACTCTCTGGAGAGTCTCGGACCTTCAGAGCTAAATCCACACCACCTCCGTCTGACTCCAC

TCCAG CTGTAGACCAACCAGTGGTAGCTGCAGGGCCAGGAGCAGCTTCCGACAGCTCCTCTCAGGTTGTGAGGCCCAAGGATAAGGCGCTCAATGCCTC

GGCTGCCCACAGCCACCAGCAGGAGCTGCCTCCCTCTGACTGTACAGGGTCTGGGTTAAGGAAGATCAAGGCCCCGGGTGCTTCCAGGTGTGATCAGCAG

ACTGGATCCTGTGTCAACCGAGGCACTCAGACCAAGAAGTCTGGGAGAAGTGGGCAGACCAAGCATCGAGGCCAGCAGCCCACTGCCAGCAGCCCCAGTG

GGCAGCAGCCATCAGCAGCAAGCAGTGATGTGCGAGACGCCTCACAAGCCCTGGAGCTAACTCAGTATTTTTTTGAGGCCGTTTCTGCACAGATGGAAAA

GTGGTATGAACGGAAAATTGAAGAAGCACGGAGCCAAGCAAGTCAGAAAGCTCAGCAGGATGAGGCCACATTGAAGGAACACATCAGAAGTCTGGAGGAG

GAGCTTGCCAGGCTGCGGACAAAGGTGCAGAAGTAAAAGCCAGACCCTCAGCTGGACCCAACAGGGTTTCCGGCTTGATAACAGCCAAGTAACGGTGTCC

CAGGAGTTGGTTGTCACGCCCAAGGTGGACTTGCCTTTTAGAAAGTCACGAATGTGTTGCGGACACATATTTCCTGTGCTCTGAAATTACAAGGCCTTCA

CTGGTTAAAATGAATCCTGGCAATATGTTCACAAAAAGCAAGCTGCACCCAGATGAGGTGTGTACCCAAGTCTGCGATTCAGTGACATGAACTATGTCGG

CAGCAAAGCAGATTACTCTGCGAGCCCAGTAGTCATTCACAGCTGCTGTGACTAGACAGTCCTTCTAACGGAGCTGGGACGCGGATGCCGGAAGCCCCTT

TTCTCCCATGTGACTCAAGATGCTCATCTTTTAAAGGGGTGAAAAGCGCTCAGGTTTTGAGGAAATACATTGTAATGATCTCAGTGTCCAGTATGTCTTA

AAGTAATGTTAAGGGTCATGTAAAGAAGGAGTAATTGCTGACTGTCAAACTCGAAAAGTTTAAAATATTGGTCAGTTACTGTGGTTTTAGCCAAATAACT

GAGCAGACTAATGGAAAAAATCCACCAAACAACTCCAGCTAGTTACCTTAGCTTGATTGCCTTTCTAACGTCAAGACTTTTGCTGGTTTGTAAATAAGGC

AGAATCATGAAAGTTTAATTTTGAGTTGACTCCTCACTGAAGAACACCAAGCCATCAGAAGGCTTTACTTGTTCGCGGAGTAAGATGTAACAGACTGAGG

TGGTGACGATATCTGGGTTGGGACCTAGGATTTGTCCTCGGATCCTTTGGAACACAGAACATGGATTATGTCCGTCTCCATGATCCACATACACATAGGA

ACTTCTGTTTCTCTAAGCCTAAGGACCTCATAAATCCTGTCCATGAATTGTGACTAAAATGCTGTTCATTGAGCCAAAGAGAAGTGACCTTTGTGAAATA

GTATGCATTTATCCCTTTGTCAAGCCAAGTTCTTCCTTTTTCTTATAGTGACACTCCATGGATGTAGACATTCCTGGAAACATACAGGGTAGATATATGA

GTACAGAATCTAGTGAGGCCAGTTATTTCATGGGACTGACCCGTCCTCAGCCTCTTGGGAGGTGCAGATTTTTCCCATTCTCCTTCACTGGAGTCCTGTC

CTCAGCTCACTTGCCCCATCCCTGCTATGACACTCCCTGGACAAAATGTCACTGGACCTGCCTAATACTAAGTAAGAGATGAAACCCCGAGTTCAGCAAG

TTATGCTCCAAGCAGGAGTTATTTTCACTATTAGAATACTTATTACCTCAAGATACCCTTGACAAGAAATGCAGACATCAACTGTAACTGAACATCAAAT

CTAGACCACAGACTACCTTGGTGGCAGTACTTTGATGCTATACCTCCTACCCATCAGAAGCAGGCAGCTTATCACTGTGAATGGATGTTTTTGTCAAGTC

ATTAAGCATAAAGCCAGGCTATTGAATAAGGCCAGTCAGCCCCTTACCCACAGGGTTGACTTCTAAGGAAGTGGTGGTTGGCTTGTTTTGGAAGGCTCTA

CTGTGTACTCTAGACTGTCTCAGCCACCTGAGTTCTGGGATTAAAGGAGTGAGCATGGCTAATCCTGTGTTGTTTGTAACACCCGTCTTAGGTTTGTTGC

AATTGTAAAGCACTGAAGATCAGCTGTGTCTTTTCCCCTTGTGCTATGTGCAAAAACAAGCAAATATCCCAGCTGTACTTTTACAGATAACTGTTTATAT

CACATACTCTCACATAGATCATGCTTCAAACTGAGGCCTAGGAAGCATCAACAGCTGTGGAGAAACATGTTATAAAACAGTAATGTTGTATATTATCAAT

GTCCTTTTTAAAAACAAGTAATTGTTAGCACATCCCTTAGACTGTATTCTGAGTATCTGTGATGGGGTGAAAGTGTTAGTCTAGCATCGCTTTTTATTTG

AGGAGTCCGGAATATAGGTTTTTCATGTTTAGATTTGTGTGTGCAAGGCATGTTGTCTGATTTTATCACATGGAACTTGTGTCTCCTATATGCATTAAAT

GTTGTTTTCAGTTC
Translation
 - UNI29946 - MSQQDAVAALSERLLIAAYKGQTENVVQLINKGAKVAVTK - UNI22852 - HGRTPLHLAANKGHLSVVQILLKAGCDLDVQD

D GDQTALHRATVVGNTEILTALIREGCALDRQDK DGNTALHEAAWHGFSQSAKLLVKAGANVLARNK AGNTALHLACQNSHSQSTRILLLGGSRADL

KNN AGDTCLHVAARYNHLSVVRLLLNAFCSVHEKNQ AGDTALHVAAALNHKKVVKVLLEAGADTTIVNN AGQTPLETARYHNNPEVALLLTKAPQ I

LRFSRGRSLRKRRERLKEERRAQSVPRDEVAQSK GSVSAGDTPSSEQAVPQKEEARRDCPPASQEPRKDERRRKSRPE VSALSDPTPAADQQPGHQKN

LHSHHHPKKKSRHRCWSPPPPHGFRAYQLYTLYRGEDGKVMQ APIKGCRCEPLINKLENQLEATVEEIRAELGSVQDKVNAKLGQMESKTQHQ MCVLD

KLMVERLSAERTECMNRLQQHAAAEKQEGEKRQ MSLVDELKAWCMLKIQSLELRLSGESRTFRAKSTPPPSDSTPA AVDQPVVAAGPGAASDSSSQVV

RPKDKALNASAAHSHQQELPPSDCTGSGLRKIKAPGASRCDQQTGSCVNRGTQTKKSGRSGQTKHRGQQPTASSPSGQQPSAASSDVRDASQALELTQYF

FEAVSAQMEKWYERKIEEARSQASQKAQQDEATLKEHIRSLEEELARLRTKVQK
Transcript ENSMUST00000108168
Sequence
CTGCTGTAGTGCCTTTGTGCTCGGCTGTCCCTTGTTCCCGCAGAGGCTAGCGAGGTCGGGAAGAACCCTCCATTGTGAATCCATTGTGGTCTGAGACTGG

ACGGAAGGTTCGGCCAGCCTGTGTGATTAGAACTGCGTCTTGGGAGTGCCTTTCCTGGATGTGGACAGAGACTCTTGACAGGGTTTGAAGTGAAAATGAG

AACTA - UNI29946 - - UNI30861 - CTGCTGAACACTTGATGCCTAGGTTGTAGCCTGTGTAACACTTCCTGTCACGGGGTGGTGGGAGGCCA

GTGGAAGAGAGACTTCCATACAAGAATCTTATTCTGGAGAGCGGCCTATGGACTTTCCCACGGATGAGTCCTGCAGCTCTTGAGAGCATCCAGGAG - U

NI29946 - GACCTGAAGATGGAGTAGTGAGAAAGGCATCCCTCAGGATTCCGAGCACCTTTCGCTGTGGACTCCAGCCCCACCCGAGGCTGCATGTGG

AGCTGAGGAAACTGACCCACCGCTTGCTTTCCTGGGAGCCCCTTTCTCTCCTAATTCATGAGCCAGCAGGATGCGGTCGCTGCGCTTTCAGAACGCCTGC

TCATAGCTGCGTACAAAGGCCAAACAGAGAATGTGGTTCAGCTCATCAACAAGGGTGCCAAGGTAGCCGTTACCAAG - UNI22852 - CATGGCCGG

ACCCCCTTGCACCTCGCTGCCAATAAGGGTCATCTTTCTGTGGTGCAGATTTTGCTGAAGGCTGGCTGTGACCTCGATGTGCAAGATGAT GGGGACCAG

ACAGCCTTGCACCGGGCCACTGTGGTGGGAAACACCGAGATCCTCACAGCGCTTATCCGGGAGGGGTGTGCCCTGGACAGACAGGACAAG GATGGGAAT

ACAGCCCTGCATGAAGCCGCCTGGCACGGATTCAGCCAGTCAGCCAAGCTGCTCGTTAAAGCCGGAGCCAATGTGCTTGCCAGAAACAAG GCAGGGAAC

ACAGCTCTGCACCTGGCCTGCCAGAATAGTCACTCCCAGAGCACTCGCATCCTCCTGCTGGGCGGCTCCCGGGCTGACCTCAAAAACAAC GCAGGGGAC

ACCTGTCTGCACGTGGCTGCGCGGTATAACCACTTGTCCGTCGTCAGACTCCTCCTCAATGCTTTCTGCTCTGTCCATGAAAAGAACCAG GCTGGAGAC

ACGGCCCTCCATGTGGCTGCTGCCCTAAATCACAAGAAGGTAGTTAAAGTCCTGCTGGAAGCTGGTGCTGACACAACCATTGTGAACAAT GCAGGCCAG

ACCCCGCTGGAGACTGCCCGCTACCACAATAATCCTGAAGTCGCACTACTCCTCACCAAGGCTCCCCAG GGAAGTGTCTCAGCAGGAGATACCCCCAGC

AGTGAACAAGCAGTACCCCAAAAAGAGGAAGCTAGAAGAGATTGTCCACCAGCTTCCCAGGAGCCAAGAAAGGATGAGAGGAGGAGAAAGTCGAGGCCAG

AG GTGTCAGCGTTATCTGACCCCACCCCAGCCGCAGACCAACAGCCTGGACACCAAAAGAACCTGCACAGTCATCACCACCCCAAAAAGAAGAGCAGAC

ATCGGTGTTGGTCCCCACCTCCACCCCACGGGTTCAGGGCGTACCAGCTATACACGCTGTACCGGGGCGAGGATGGAAAAGTGATGCAG GCACCAATAA

AAGGTTGTCGCTGTGAACCTCTAATCAACAAGCTGGAGAACCAGTTGGAGGCGACTGTGGAGGAAATCAGAGCTGAGTTAGGCTCGGTGCAGGATAAAGT

GAACGCGAAGCTGGGCCAGATGGAGAGCAAAACCCAGCACCAA ATGTGCGTTTTGGACAAACTGATGGTGGAACGGCTGTCCGCGGAGAGAACAGAATG

CATGAATCGCCTGCAACAGCATGCAGCTGCTGAGAAGCAGGAGGGAGAGAAACGTCAG ATGTCTTTGGTAGATGAACTAAAAGCCTGGTGCATGTTGAA

GATCCAGAGTCTGGAGCTAAGACTCTCTGGAGAGTCTCGGACCTTCAGAGCTAAATCCACACCACCTCCGTCTGACTCCACTCCAG CTGTAGACCAACC

AGTGGTAGCTGCAGGGCCAGGAGCAGCTTCCGACAGCTCCTCTCAGGTTGTGAGGCCCAAGGATAAGGCGCTCAATGCCTCGGCTGCCCACAGCCACCAG

CAGGAGCTGCCTCCCTCTGACTGTACAGGGTCTGGGTTAAGGAAGATCAAGGCCCCGGGTGCTTCCAGGTGTGATCAGCAGACTGGATCCTGTGTCAACC

GAGGCACTCAGACCAAGAAGTCTGGGAGAAGTGGGCAGACCAAGCATCGAGGCCAGCAGCCCACTGCCAGCAGCCCCAGTGGGCAGCAGCCATCAGCAGC

AAGCAGTGATGTGCGAGACGCCTCACAAGCCCTGGAGCTAACTCAGTATTTTTTTGAGGCCGTTTCTGCACAGATGGAAAAGTGGTATGAACGGAAAATT

GAAGAAGCACGGAGCCAAGCAAGTCAGAAAGCTCAGCAGGATGAGGCCACATTGAAGGAACACATCAGAAGTCTGGAGGAGGAGCTTGCCAGGCTGCGGA

CAAAGGTGCAGAAGTAAAAGCCAGACCCTCAGCTGGACCCAACAGGGTTTCCGGCTTGATAACAGCCAAGTAACGGTGTCCCAGGAGTTGGTTGTCACGC

CCAAGGTGGACTTGCCTTTTAGAAAGTCACGAATGTGTTGCGGACACATATTTCCTGTGCTCTGAAATTACAAGGCCTTCACTGGTTAAAATGAATCCTG

GCAATATGTTCACAAAAAGCAAGCTGCACCCAGATGAGGTGTGTACCCAAGTCTGCGATTCAGTGACATGAACTATGTCGGCAGCAAAGCAGATTACTCT

GCGAGCCCAGTAGTCATTCACAGCTGCTGTGACTAGACAGTCCTTCTAACGGAGCTGGGACGCGGATGCCGGAAGCCCCTTTTCTCCCATGTGACTCAAG

ATGCTCATCTTTTAAAGGGGTGAAAAGCGCTCAGGTTTTGAGGAAATACATTGTAATGATCTCAGTGTCCAGTATGTCTTAAAGTAATGTTAAGGGTCAT

GTAAAGAAGGAGTAATTGCTGACTGTCAAACTCGAAAAGTTTAAAATATTGGTCAGTTACTGTGGTTTTAGCCAAATAACTGAGCAGACTAATGGAAAAA

ATCCACCAAACAACTCCAGCTAGTTACCTTAGCTTGATTGCCTTTCTAACGTCAAGACTTTTGCTGGTTTGTAAATAAGGCAGAATCATGAAAGTTTAAT

TTTGAGTTGACTCCTCACTGAAGAACACCAAGCCATCAGAAGGCTTTACTTGTTCGCGGAGTAAGATGTAACAGACTGAGGTGGTGACGATATCTGGGTT

GGGACCTAGGATTTGTCCTCGGATCCTTTGGAACACAGAACATGGATTATGTCCGTCTCCATGATCCACATACACATAGGAACTTCTGTTTCTCTAAGCC

TAAGGACCTCATAAATCCTGTCCATGAATTGTGACTAAAATGCTGTTCATTGAGCCAAAGAGAAGTGACCTTTGTGAAATAGTATGCATTTATCCCTTTG

TCAAGCCAAGTTCTTCCTTTTTCTTATAGTGACACTCCATGGATGTAGACATTCCTGGAAACATACAGGGTAGATATATGAGTACAGAATCTAGTGAGGC

CAGTTATTTCATGGGACTGACCCGTCCTCAGCCTCTTGGGAGGTGCAGATTTTTCCCATTCTCCTTCACTGGAGTCCTGTCCTCAGCTCACTTGCCCCAT

CCCTGCTATGACACTCCCTGGACAAAATGTCACTGGACCTGCCTAATACTAAGTAAGAGATGAAACCCCGAGTTCAGCAAGTTATGCTCCAAGCAGGAGT

TATTTTCACTATTAGAATACTTATTACCTCAAGATACCCTTGACAAGAAATGCAGACATCAACTGTAACTGAACATCAAATCTAGACCACAGACTACCTT

GGTGGCAGTACTTTGATGCTATACCTCCTACCCATCAGAAGCAGGCAGCTTATCACTGTGAATGGATGTTTTTGTCAAGTCATTAAGCATAAAGCCAGGC

TATTGAATAAGGCCAGTCAGCCCCTTACCCACAGGGTTGACTTCTAAGGAAGTGGTGGTTGGCTTGTTTTGGAAGGCTCTACTGTGTACTCTAGACTGTC

TCAGCCACCTGAGTTCTGGGATTAAAGGAGTGAGCATGGCTAATCCTGTGTTGTTTGTAACACCCGTCTTAGGTTTGTTGCAATTGTAAAGCACTGAAGA

TCAGCTGTGTCTTTTCCCCTTGTGCTATGTGCAAAAACAAGCAAATATCCCAGCTGTACTTTTACAGATAACTGTTTATATCACATACTCTCACATAGAT

CATGCTTCAAACTGAGGCCTAGGAAGCATCAACAGCTGTGGAGAAACATGTTATAAAACAGTAATGTTGTATATTATCAATGTCCTTTTTAAAAACAAGT

AATTGTTAGCACATCCCTTAGACTGTATTCTGAGTATCTGTGATGGGGTGAAAGTGTTAGTCTAGCATCGCTTTTTATTTGAGGAGTCCGGAATATAGGT

TTTTCATGTTTAGATTTGTGTGTGCAAGGCATGTTGTCTGATTTTATCACATGGAACTTGTGTCTCCTATATGCATTAAATGTTGTTTTCAGTTC
Translation
 - UNI29946 - - UNI30861 -  - UNI29946 - MSQQDAVAALSERLLIAAYKGQTENVVQLINKGAKVAVTK - UNI22852 - HGRTP

LHLAANKGHLSVVQILLKAGCDLDVQDD GDQTALHRATVVGNTEILTALIREGCALDRQDK DGNTALHEAAWHGFSQSAKLLVKAGANVLARNK AGN

TALHLACQNSHSQSTRILLLGGSRADLKNN AGDTCLHVAARYNHLSVVRLLLNAFCSVHEKNQ AGDTALHVAAALNHKKVVKVLLEAGADTTIVNN A

GQTPLETARYHNNPEVALLLTKAPQ GSVSAGDTPSSEQAVPQKEEARRDCPPASQEPRKDERRRKSRPE VSALSDPTPAADQQPGHQKNLHSHHHPKK

KSRHRCWSPPPPHGFRAYQLYTLYRGEDGKVMQ APIKGCRCEPLINKLENQLEATVEEIRAELGSVQDKVNAKLGQMESKTQHQ MCVLDKLMVERLSA

ERTECMNRLQQHAAAEKQEGEKRQ MSLVDELKAWCMLKIQSLELRLSGESRTFRAKSTPPPSDSTPA AVDQPVVAAGPGAASDSSSQVVRPKDKALNA

SAAHSHQQELPPSDCTGSGLRKIKAPGASRCDQQTGSCVNRGTQTKKSGRSGQTKHRGQQPTASSPSGQQPSAASSDVRDASQALELTQYFFEAVSAQME

KWYERKIEEARSQASQKAQQDEATLKEHIRSLEEELARLRTKVQK
Transcript ENSMUST00000035719
Sequence
CTGCTGTAGTGCCTTTGTGCTCGGCTGTCCCTTGTTCCCGCAGAGGCTAGCGAGGTCGGGAAGAACCCTCCATTGTGAATCCATTGTGGTCTGAGACTGG

ACGGAAGGTTCGGCCAGCCTGTGTGATTAGAACTGCGTCTTGGGAGTGCCTTTCCTGGATGTGGACAGAGACTCTTGACAGGGTTTGAAGTGAAAATGAG

AACTA - UNI29946 - - UNI30861 - CTGCTGAACACTTGATGCCTAGGTTGTAGCCTGTGTAACACTTCCTGTCACGGGGTGGTGGGAGGCCA

GTGGAAGAGAGACTTCCATACAAGAATCTTATTCTGGAGAGCGGCCTATGGACTTTCCCACGGATGAGTCCTGCAGCTCTTGAGAGCATCCAGGAG - U

NI29946 - GACCTGAAGATGGAGTAGTGAGAAAGGCATCCCTCAGGATTCCGAGCACCTTTCGCTGTGGACTCCAGCCCCACCCGAGGCTGCATGTGG

AGCTGAGGAAACTGACCCACCGCTTGCTTTCCTGGGAGCCCCTTTCTCTCCTAATTCATGAGCCAGCAGGATGCGGTCGCTGCGCTTTCAGAACGCCTGC

TCATAGCTGCGTACAAAGGCCAAACAGAGAATGTGGTTCAGCTCATCAACAAGGGTGCCAAGGTAGCCGTTACCAAG - UNI22852 - CATGGCCGG

ACCCCCTTGCACCTCGCTGCCAATAAGGGTCATCTTTCTGTGGTGCAGATTTTGCTGAAGGCTGGCTGTGACCTCGATGTGCAAGATGAT GGGGACCAG

ACAGCCTTGCACCGGGCCACTGTGGTGGGAAACACCGAGATCCTCACAGCGCTTATCCGGGAGGGGTGTGCCCTGGACAGACAGGACAAG GATGGGAAT

ACAGCCCTGCATGAAGCCGCCTGGCACGGATTCAGCCAGTCAGCCAAGCTGCTCGTTAAAGCCGGAGCCAATGTGCTTGCCAGAAACAAG GCAGGGAAC

ACAGCTCTGCACCTGGCCTGCCAGAATAGTCACTCCCAGAGCACTCGCATCCTCCTGCTGGGCGGCTCCCGGGCTGACCTCAAAAACAAC GCAGGGGAC

ACCTGTCTGCACGTGGCTGCGCGGTATAACCACTTGTCCGTCGTCAGACTCCTCCTCAATGCTTTCTGCTCTGTCCATGAAAAGAACCAG GCTGGAGAC

ACGGCCCTCCATGTGGCTGCTGCCCTAAATCACAAGAAGGTAGTTAAAGTCCTGCTGGAAGCTGGTGCTGACACAACCATTGTGAACAAT GCAGGCCAG

ACCCCGCTGGAGACTGCCCGCTACCACAATAATCCTGAAGTCGCACTACTCCTCACCAAGGCTCCCCAG ATCTTGCGCTTCAGTCGTGGGCGAAGCCTG

AGGAAAAGGAGAGAGAGGCTCAAGGAAGAGAGGAGGGCCCAGTCTGTGCCCCGAGATGAGGTGGCACAGAGCAAG GGAAGTGTCTCAGCAGGAGATACC

CCCAGCAGTGAACAAGCAGTACCCCAAAAAGAGGAAGCTAGAAGAGATTGTCCACCAGCTTCCCAGGAGCCAAGAAAGGATGAGAGGAGGAGAAAGTCGA

GGCCAGAG GTGTCAGCGTTATCTGACCCCACCCCAGCCGCAGACCAACAGCCTGGACACCAAAAGAACCTGCACAGTCATCACCACCCCAAAAAGAAGA

GCAGACATCGGTGTTGGTCCCCACCTCCACCCCACGGGTTCAGGGCGTACCAGCTATACACGCTGTACCGGGGCGAGGATGGAAAAGTGATGCAG GCAC

CAATAAAAGGTTGTCGCTGTGAACCTCTAATCAACAAGCTGGAGAACCAGTTGGAGGCGACTGTGGAGGAAATCAGAGCTGAGTTAGGCTCGGTGCAGGA

TAAAGTGAACGCGAAGCTGGGCCAGATGGAGAGCAAAACCCAGCACCAA ATGTGCGTTTTGGACAAACTGATGGTGGAACGGCTGTCCGCGGAGAGAAC

AGAATGCATGAATCGCCTGCAACAGCATGCAGCTGCTGAGAAGCAGGAGGGAGAGAAACGTCAG ATGTCTTTGGTAGATGAACTAAAAGCCTGGTGCAT

GTTGAAGATCCAGAGTCTGGAGCTAAGACTCTCTGGAGAGTCTCGGACCTTCAGAGCTAAATCCACACCACCTCCGTCTGACTCCACTCCAG CTGTAGA

CCAACCAGTGGTAGCTGCAGGGCCAGGAGCAGCTTCCGACAGCTCCTCTCAGGTTGTGAGGCCCAAGGATAAGGCGCTCAATGCCTCGGCTGCCCACAGC

CACCAGCAGGAGCTGCCTCCCTCTGACTGTACAGGGTCTGGGTTAAGGAAGATCAAGGCCCCGGGTGCTTCCAGGTGTGATCAGCAGACTGGATCCTGTG

TCAACCGAGGCACTCAGACCAAGAAGTCTGGGAGAAGTGGGCAGACCAAGCATCGAGGCCAGCAGCCCACTGCCAGCAGCCCCAGTGGGCAGCAGCCATC

AGCAGCAAGCAGTGATGTGCGAGACGCCTCACAAGCCCTGGAGCTAACTCAGTATTTTTTTGAGGCCGTTTCTGCACAGATGGAAAAGTGGTATGAACGG

AAAATTGAAGAAGCACGGAGCCAAGCAAGTCAGAAAGCTCAGCAGGATGAGGCCACATTGAAGGAACACATCAGAAGTCTGGAGGAGGAGCTTGCCAGGC

TGCGGACAAAGGTGCAGAAGTAAAAGCCAGACCCTCAGCTGGACCCAACAGGGTTTCCGGCTTGATAACAGCCAAGTAACGGTGTCCCAGGAGTTGGTTG

TCACGCCCAAGGTGGACTTGCCTTTTAGAAAGTCACGAATGTGTTGCGGACACATATTTCCTGTGCTCTGAAATTACAAGGCCTTCACTGGTTAAAATGA

ATCCTGGCAATATGTTCACAAAAAGCAAGCTGCACCCAGATGAGGTGTGTACCCAAGTCTGCGATTCAGTGACATGAACTATGTCGGCAGCAAAGCAGAT

TACTCTGCGAGCCCAGTAGTCATTCACAGCTGCTGTGACTAGACAGTCCTTCTAACGGAGCTGGGACGCGGATGCCGGAAGCCCCTTTTCTCCCATGTGA

CTCAAGATGCTCATCTTTTAAAGGGGTGAAAAGCGCTCAGGTTTTGAGGAAATACATTGTAATGATCTCAGTGTCCAGTATGTCTTAAAGTAATGTTAAG

GGTCATGTAAAGAAGGAGTAATTGCTGACTGTCAAACTCGAAAAGTTTAAAATATTGGTCAGTTACTGTGGTTTTAGCCAAATAACTGAGCAGACTAATG

GAAAAAATCCACCAAACAACTCCAGCTAGTTACCTTAGCTTGATTGCCTTTCTAACGTCAAGACTTTTGCTGGTTTGTAAATAAGGCAGAATCATGAAAG

TTTAATTTTGAGTTGACTCCTCACTGAAGAACACCAAGCCATCAGAAGGCTTTACTTGTTCGCGGAGTAAGATGTAACAGACTGAGGTGGTGACGATATC

TGGGTTGGGACCTAGGATTTGTCCTCGGATCCTTTGGAACACAGAACATGGATTATGTCCGTCTCCATGATCCACATACACATAGGAACTTCTGTTTCTC

TAAGCCTAAGGACCTCATAAATCCTGTCCATGAATTGTGACTAAAATGCTGTTCATTGAGCCAAAGAGAAGTGACCTTTGTGAAATAGTATGCATTTATC

CCTTTGTCAAGCCAAGTTCTTCCTTTTTCTTATAGTGACACTCCATGGATGTAGACATTCCTGGAAACATACAGGGTAGATATATGAGTACAGAATCTAG

TGAGGCCAGTTATTTCATGGGACTGACCCGTCCTCAGCCTCTTGGGAGGTGCAGATTTTTCCCATTCTCCTTCACTGGAGTCCTGTCCTCAGCTCACTTG

CCCCATCCCTGCTATGACACTCCCTGGACAAAATGTCACTGGACCTGCCTAATACTAAGTAAGAGATGAAACCCCGAGTTCAGCAAGTTATGCTCCAAGC

AGGAGTTATTTTCACTATTAGAATACTTATTACCTCAAGATACCCTTGACAAGAAATGCAGACATCAACTGTAACTGAACATCAAATCTAGACCACAGAC

TACCTTGGTGGCAGTACTTTGATGCTATACCTCCTACCCATCAGAAGCAGGCAGCTTATCACTGTGAATGGATGTTTTTGTCAAGTCATTAAGCATAAAG

CCAGGCTATTGAATAAGGCCAGTCAGCCCCTTACCCACAGGGTTGACTTCTAAGGAAGTGGTGGTTGGCTTGTTTTGGAAGGCTCTACTGTGTACTCTAG

ACTGTCTCAGCCACCTGAGTTCTGGGATTAAAGGAGTGAGCATGGCTAATCCTGTGTTGTTTGTAACACCCGTCTTAGGTTTGTTGCAATTGTAAAGCAC

TGAAGATCAGCTGTGTCTTTTCCCCTTGTGCTATGTGCAAAAACAAGCAAATATCCCAGCTGTACTTTTACAGATAACTGTTTATATCACATACTCTCAC

ATAGATCATGCTTCAAACTGAGGCCTAGGAAGCATCAACAGCTGTGGAGAAACATGTTATAAAACAGTAATGTTGTATATTATCAATGTCCTTTTTAAAA

ACAAGTAATTGTTAGCACATCCCTTAGACTGTATTCTGAGTATCTGTGATGGGGTGAAAGTGTTAGTCTAGCATCGCTTTTTATTTGAGGAGTCCGGAAT

ATAGGTTTTTCATGTTTAGATTTGTGTGTGCAAGGCATGTTGTCTGATTTTATCACATGGAACTTGTGTCTCCTATATGCATTAAATGTTGTTTTCAGTT

C
Translation
 - UNI29946 - - UNI30861 -  - UNI29946 - MSQQDAVAALSERLLIAAYKGQTENVVQLINKGAKVAVTK - UNI22852 - HGRTP

LHLAANKGHLSVVQILLKAGCDLDVQDD GDQTALHRATVVGNTEILTALIREGCALDRQDK DGNTALHEAAWHGFSQSAKLLVKAGANVLARNK AGN

TALHLACQNSHSQSTRILLLGGSRADLKNN AGDTCLHVAARYNHLSVVRLLLNAFCSVHEKNQ AGDTALHVAAALNHKKVVKVLLEAGADTTIVNN A

GQTPLETARYHNNPEVALLLTKAPQ ILRFSRGRSLRKRRERLKEERRAQSVPRDEVAQSK GSVSAGDTPSSEQAVPQKEEARRDCPPASQEPRKDERR

RKSRPE VSALSDPTPAADQQPGHQKNLHSHHHPKKKSRHRCWSPPPPHGFRAYQLYTLYRGEDGKVMQ APIKGCRCEPLINKLENQLEATVEEIRAEL

GSVQDKVNAKLGQMESKTQHQ MCVLDKLMVERLSAERTECMNRLQQHAAAEKQEGEKRQ MSLVDELKAWCMLKIQSLELRLSGESRTFRAKSTPPPSD

STPA AVDQPVVAAGPGAASDSSSQVVRPKDKALNASAAHSHQQELPPSDCTGSGLRKIKAPGASRCDQQTGSCVNRGTQTKKSGRSGQTKHRGQQPTAS

SPSGQQPSAASSDVRDASQALELTQYFFEAVSAQMEKWYERKIEEARSQASQKAQQDEATLKEHIRSLEEELARLRTKVQK
Transcript ENSMUST00000084750
Sequence
GTGGGGCGAGCGGCTGCGGGCAAGGAGCGCAGCGGCCCGCGAGCTCCGTGCGGAGCGGCCGGCCGGCGCGGGAGCGAAAG - UNI29946 - - UNI3

0861 - GACCTGAAGATGGAGTAGTGAGAAAGGCATCCCTCAGGATTCCGAGCACCTTTCGCTGTGGACTCCAGCCCCACCCGAGGCTGCATGTGGAGC

TGAGGAAACTGACCCACCGCTTGCTTTCCTGGGAGCCCCTTTCTCTCCTAATTCATGAGCCAGCAGGATGCGGTCGCTGCGCTTTCAGAACGCCTGCTCA

TAGCTGCGTACAAAGGCCAAACAGAGAATGTGGTTCAGCTCATCAACAAGGGTGCCAAGGTAGCCGTTACCAAG - UNI22852 - CATGGCCGGACC

CCCTTGCACCTCGCTGCCAATAAGGGTCATCTTTCTGTGGTGCAGATTTTGCTGAAGGCTGGCTGTGACCTCGATGTGCAAGATGAT GGGGACCAGACA

GCCTTGCACCGGGCCACTGTGGTGGGAAACACCGAGATCCTCACAGCGCTTATCCGGGAGGGGTGTGCCCTGGACAGACAGGACAAG GATGGGAATACA

GCCCTGCATGAAGCCGCCTGGCACGGATTCAGCCAGTCAGCCAAGCTGCTCGTTAAAGCCGGAGCCAATGTGCTTGCCAGAAACAAG GCAGGGAACACA

GCTCTGCACCTGGCCTGCCAGAATAGTCACTCCCAGAGCACTCGCATCCTCCTGCTGGGCGGCTCCCGGGCTGACCTCAAAAACAAC GCAGGGGACACC

TGTCTGCACGTGGCTGCGCGGTATAACCACTTGTCCGTCGTCAGACTCCTCCTCAATGCTTTCTGCTCTGTCCATGAAAAGAACCAG GCTGGAGACACG

GCCCTCCATGTGGCTGCTGCCCTAAATCACAAGAAGGTAGTTAAAGTCCTGCTGGAAGCTGGTGCTGACACAACCATTGTGAACAAT GCAGGCCAGACC

CCGCTGGAGACTGCCCGCTACCACAATAATCCTGAAGTCGCACTACTCCTCACCAAGGCTCCCCAG ATCTTGCGCTTCAGTCGTGGGCGAAGCCTGAGG

AAAAGGAGAGAGAGGCTCAAGGAAGAGAGGAGGGCCCAGTCTGTGCCCCGAGATGAGGTGGCACAGAGCAAG GGAAGTGTCTCAGCAGGAGATACCCCC

AGCAGTGAACAAGCAGTACCCCAAAAAGAGGAAGCTAGAAGAGATTGTCCACCAGCTTCCCAGGAGCCAAGAAAGGATGAGAGGAGGAGAAAGTCGAGGC

CAGAG GTGTCAGCGTTATCTGACCCCACCCCAGCCGCAGACCAACAGCCTGGACACCAAAAGAACCTGCACAGTCATCACCACCCCAAAAAGAAGAGCA

GACATCGGTGTTGGTCCCCACCTCCACCCCACGGGTTCAGGGCGTACCAGCTATACACGCTGTACCGGGGCGAGGATGGAAAAGTGATGCAG GCACCAA

TAAAAGGTTGTCGCTGTGAACCTCTAATCAACAAGCTGGAGAACCAGTTGGAGGCGACTGTGGAGGAAATCAGAGCTGAGTTAGGCTCGGTGCAGGATAA

AGTGAACGCGAAGCTGGGCCAGATGGAGAGCAAAACCCAGCACCAA ATGTGCGTTTTGGACAAACTGATGGTGGAACGGCTGTCCGCGGAGAGAACAGA

ATGCATGAATCGCCTGCAACAGCATGCAGCTGCTGAGAAGCAGGAGGGAGAGAAACGTCAG ATGTCTTTGGTAGATGAACTAAAAGCCTGGTGCATGTT

GAAGATCCAGAGTCTGGAGCTAAGACTCTCTGGAGAGTCTCGGACCTTCAGAGCTAAATCCACACCACCTCCGTCTGACTCCACTCCAG CTGTAGACCA

ACCAGTGGTAGCTGCAGGGCCAGGAGCAGCTTCCGACAGCTCCTCTCAGGTTGTGAGGCCCAAGGATAAGGCGCTCAATGCCTCGGCTGCCCACAGCCAC

CAGCAGGAGCTGCCTCCCTCTGACTGTACAGGGTCTGGGTTAAGGAAGATCAAGGCCCCGGGTGCTTCCAGGTGTGATCAGCAGACTGGATCCTGTGTCA

ACCGAGGCACTCAGACCAAGAAGTCTGGGAGAAGTGGGCAGACCAAGCATCGAGGCCAGCAGCCCACTGCCAGCAGCCCCAGTGGGCAGCAGCCATCAGC

AGCAAGCAGTGATGTGCGAGACGCCTCACAAGCCCTGGAGCTAACTCAGTATTTTTTTGAGGCCGTTTCTGCACAGATGGAAAAGTGGTATGAACGGAAA

ATTGAAGAAGCACGGAGCCAAGCAAGTCAGAAAGCTCAGCAGGATGAGGCCACATTGAAGGAACACATCAGAAGTCTGGAGGAGGAGCTTGCCAGGCTGC

GGACAAAGGTGCAGAAGTAAAAGCCAGACCCTCAGCTGGACCCAACAGGGTTTCCGGCTTGATAACAGCCAAGTAACGGTGTCCCAGGAGTTGGTTGTCA

CGCCCAAGGTGGACTTGCCTTTTAGAAAGTCACGAATGTGTTGCGGACACATATTTCCTGTGCTCTGAAATTACAAGGCCTTCACTGGTTAAAATGAATC

CTGGCAATATGTTCACAAAAAGCAAGCTGCACCCAGATGAGGTGTGTACCCAAGTCTGCGATTCAGTGACATGAACTATGTCGGCAGCAAAGCAGATTAC

TCTGCGAGCCCAGTAGTCATTCACAGCTGCTGTGACTAGACAGTCCTTCTAACGGAGCTGGGACGCGGATGCCGGAAGCCCCTTTTCTCCCATGTGACTC

AAGATGCTCATCTTTTAAAGGGGTGAAAAGCGCTCAGGTTTTGAGGAAATACATTGTAATGATCTCAGTGTCCAGTATGTCTTAAAGTAATGTTAAGGGT

CATGTAAAGAAGGAGTAATTGCTGACTGTCAAACTCGAAAAGTTTAAAATATTGGTCAGTTACTGTGGTTTTAGCCAAATAACTGAGCAGACTAATGGAA

AAAATCCACCAAACAACTCCAGCTAGTTACCTTAGCTTGATTGCCTTTCTAACGTCAAGACTTTTGCTGGTTTGTAAATAAGGCAGAATCATGAAAGTTT

AATTTTGAGTTGACTCCTCACTGAAGAACACCAAGCCATCAGAAGGCTTTACTTGTTCGCGGAGTAAGATGTAACAGACTGAGGTGGTGACGATATCTGG

GTTGGGACCTAGGATTTGTCCTCGGATCCTTTGGAACACAGAACATGGATTATGTCCGTCTCCATGATCCACATACACATAGGAACTTCTGTTTCTCTAA

GCCTAAGGACCTCATAAATCCTGTCCATGAATTGTGACTAAAATGCTGTTCATTGAGCCAAAGAGAAGTGACCTTTGTGAAATAGTATGCATTTATCCCT

TTGTCAAGCCAAGTTCTTCCTTTTTCTTATAGTGACACTCCATGGATGTAGACATTCCTGGAAACATACAGGGTAGATATATGAGTACAGAATCTAGTGA

GGCCAGTTATTTCATGGGACTGACCCGTCCTCAGCCTCTTGGGAGGTGCAGATTTTTCCCATTCTCCTTCACTGGAGTCCTGTCCTCAGCTCACTTGCCC

CATCCCTGCTATGACACTCCCTGGACAAAATGTCACTGGACCTGCCTAATACTAAGTAAGAGATGAAACCCCGAGTTCAGCAAGTTATGCTCCAAGCAGG

AGTTATTTTCACTATTAGAATACTTATTACCTCAAGATACCCTTGACAAGAAATGCAGACATCAACTGTAACTGAACATCAAATCTAGACCACAGACTAC

CTTGGTGGCAGTACTTTGATGCTATACCTCCTACCCATCAGAAGCAGGCAGCTTATCACTGTGAATGGATGTTTTTGTCAAGTCATTAAGCATAAAGCCA

GGCTATTGAATAAGGCCAGTCAGCCCCTTACCCACAGGGTTGACTTCTAAGGAAGTGGTGGTTGGCTTGTTTTGGAAGGCTCTACTGTGTACTCTAGACT

GTCTCAGCCACCTGAGTTCTGGGATTAAAGGAGTGAGCATGGCTAATCCTGTGTTGTTTGTAACACCCGTCTTAGGTTTGTTGCAATTGTAAAGCACTGA

AGATCAGCTGTGTCTTTTCCCCTTGTGCTATGTGCAAAAACAAGCAAATATCCCAGCTGTACTTTTACAGATAACTGTTTATATCACATACTCTCACATA

GATCATGCTTCAAACTGAGGCCTAGGAAGCATCAACAGCTGTGGAGAAACATGTTATAAAACAGTAATGTTGTATATTATCAATGTCCTTTTTAAAAACA

AGTAATTGTTAGCACATCCCTTAGACTGTATTCTGAGTATCTGTGATGGGGTGAAAGTGTTAGTCTAGCATCGCTTTTTATTTGAGGAGTCCGGAATATA

GGTTTTTCATGTTTAGATTTGTGTGTGCAAGGCATGTTGTCTGATTTTATCACATGGAACTTGTGTCTCCTATATGCATTAAATGTTGTTTTCAGTTC
Translation
 - UNI29946 - - UNI30861 - MSQQDAVAALSERLLIAAYKGQTENVVQLINKGAKVAVTK - UNI22852 - HGRTPLHLAANKGHLSVVQ

ILLKAGCDLDVQDD GDQTALHRATVVGNTEILTALIREGCALDRQDK DGNTALHEAAWHGFSQSAKLLVKAGANVLARNK AGNTALHLACQNSHSQS

TRILLLGGSRADLKNN AGDTCLHVAARYNHLSVVRLLLNAFCSVHEKNQ AGDTALHVAAALNHKKVVKVLLEAGADTTIVNN AGQTPLETARYHNNP

EVALLLTKAPQ ILRFSRGRSLRKRRERLKEERRAQSVPRDEVAQSK GSVSAGDTPSSEQAVPQKEEARRDCPPASQEPRKDERRRKSRPE VSALSDP

TPAADQQPGHQKNLHSHHHPKKKSRHRCWSPPPPHGFRAYQLYTLYRGEDGKVMQ APIKGCRCEPLINKLENQLEATVEEIRAELGSVQDKVNAKLGQM

ESKTQHQ MCVLDKLMVERLSAERTECMNRLQQHAAAEKQEGEKRQ MSLVDELKAWCMLKIQSLELRLSGESRTFRAKSTPPPSDSTPA AVDQPVVAA

GPGAASDSSSQVVRPKDKALNASAAHSHQQELPPSDCTGSGLRKIKAPGASRCDQQTGSCVNRGTQTKKSGRSGQTKHRGQQPTASSPSGQQPSAASSDV

RDASQALELTQYFFEAVSAQMEKWYERKIEEARSQASQKAQQDEATLKEHIRSLEEELARLRTKVQK

For any suggestions or comments, please send an email to unitrap@crg.es