Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040268 (Plekha1)
Chromosomal location
Chr 7: 138009270 - 138056826 (+)
Description
pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 1 Gene [Source:MGI (curated);Acc:Plekha1-002]
RefSeq_dna
NM_133942 
RefSeq_peptide
NP_598703.1 
UniGene
Mm.323554 Mm.473925 
MGI
MGI:2442213 
Uniprot/SWISSPROT
Q8BUL6 
Human Ortholog
ENSG00000107679 (PLEKHA1)
Omim not available
UniTrap UNI31689
Vector Insertion
Chr 7: 138009515 - 138021247
Public Clones (sanger) IST14670H7 (tigm) IST13234G6 (tigm) IST14595B7 (tigm) IST14259G8 (tigm)
IST14152H9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19064
Vector Insertion
Chr 7: 138021247 - 138021409
Public Clones CMHD-GT_465E7-3 (cmhd)
Private Clones OST405816 (lexicon) OST371001 (lexicon) OST315144 (lexicon) OST288440 (lexicon)
OST286287 (lexicon) OST280386 (lexicon) OST276880 (lexicon) OST212536 (lexicon)
OST204625 (lexicon) OST111213 (lexicon) OST111205 (lexicon) OST57171 (lexicon)
OST35546 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23799
Vector Insertion
Chr 7: 138021409 - 138025843
Public Clones IST14978H9 (tigm)
Private Clones OST244508 (lexicon) OST197685 (lexicon)
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10418
Vector Insertion
Chr 7: 138028963 - 138035694
Public Clones (sanger) D099E10 (ggtc) E120H01 (ggtc) D067E10 (ggtc) E080F06 (ggtc)
E133A06 (ggtc) CMHD-GT_540C1-5S (cmhd) CMHD-GT_540C1-3 (cmhd) CMHD-GT_311F03-3 (cmhd)
FHCRC-GT-S17-10A2 (fhcrc) FHCRC-GT-S17-10A1 (fhcrc) IST10980D6 (tigm)
Private Clones OST403942 (lexicon) OST372493 (lexicon) OST289167 (lexicon) OST267873 (lexicon)
OST185936 (lexicon) OST52421 (lexicon) OST37240 (lexicon)
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11720
Vector Insertion
Chr 7: 138035793 - 138040838
Public Clones Q013A04 (ggtc)
Private Clones OST299597 (lexicon) OST276204 (lexicon)
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26112
Vector Insertion
Chr 7: 138044175 - 138045690
Public Clones not available
Private Clones OST136794 (lexicon)
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19305
Vector Insertion
Chr 7: 138048969 - 138051849
Public Clones not available
Private Clones OST395653 (lexicon)
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22729
Vector Insertion
Chr 7: 138054345 - 138054998
Public Clones not available
Private Clones OST286189 (lexicon)
Severity of mutation (?) Insertion after 71% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000106198
Sequence
GGGCCGTCGTGGGCGCCGCTCCCGGCAGCTGGGTGCCTGAAGGAGCCGGGACCGCGGTGGCGCGGGTGCTCCGGGCGGAGGCCGCGGTAAAGTGGGGCAT

GAG - UNI19064 - - UNI31689 - TGTAATGTTCAAGCCCAGAAATGCCTTATGTGGATCGACAGAATCGCATCTGTGGATTTCTAGACATTGA

AGAAAATGAGAACAGTGGGAAATTTCTTCGACGGTATTTCATCCTGGATACCAGAGAAGACAGCTTTGTATGGTACATGGATAATCCACAG - UNI190

64 - - UNI23799 - AACCTGCCTTCAGGATCGTCACGGGTTGGAGCCATTAAACTTACCTACATTTCAAAG - UNI10418 - - UNI11720 

- GTACCAAAGCAGTCAGACTCACAGCCGGCCTCCGACAGCCTGAGTCGCCAAGGTGACTGTGGTAAGAAGCAAGTGTCTTACAGAACTGACATTGTTGG

TGGTGTGCCCATCATCACGCCGACGCAG AAAGAAGAAGTAAACGAATGTGGTGAGAGTCTGGATAGAAACAATTTGAAACGGTCACAGAGCCATCTTCC

TTACTTTGCTCCTAAGCCACCTTCAGACAGTGCAGTTATCAAAGCTGGGTATTGTGTGAAGCAAGGAGCGGTG - UNI26112 - ATGAAAAACTGGA

AGAGAAGATATTTTCAATTGGATGAAAACACAATAGGCTACTTCAAATCTGAACTG GAGAAGGAACCTCTGCGGGTGATACCACTTAAAGAAGTGCACA

AAGTCCAGGAGTGCAAACAGAG TGACATAATGATGAGGGACAACCTGTTTGAAATCGTGACGACATCTCGGACTTTCTATGTGCAG - UNI19305 -

 GCTGATAGCCCTGAAGAGATGCACAGTTGGATTAAAGCAGTCTCTGGCGCCATCGTAGCACAGCGGGGACCTGGCAGGTCATCCTCTTCT - UNI227

29 - GAGCATTCCGGCTGGCCTTCAGAACCCAAATTCACTGTCCGTCCTGCCGGGGCCGCAGCCACCGCCTCACATTCCCCAGCCTCTCGCAGCCACTC

TCTGGTCTCAGGCTGTGCCATGGAGAAGCGAGGAGTTTACCAATCTCTTGCCAAGGTCAAGCCAGGGAACTTCAAGGTCCAGACTGTCTCTCCAAGAGAG

CCAGCTTCCAAAGTGACTGAACAGGCTTTGCTCAGACCTCAGAGTAAAAACGGCCCTCAGGGAGAAGATGGCGAGCCAGTGGACTTAGATGACGCCAGCC

TGCCAGTCAGCGATGTGTGAGGAGGCTCTCGTGGGCTGCCTGCGCCACTCACCCTCAGTGTCCTTCCGTGAGGCTTCTCGCCAAAGATGATAGAGGGTGA

ATGATCTCAGTGCATATGTCATACTGCCTTGTGGGTGGACTCTAAGTTGGCAAACCAAGGATTTAGGGAGTGGCCTAGTCAACATAATTCTTTAAGAAAG

GAAGGAGAAAAGCTGTGTCCATAGTGACTGTTTGAAGCTTTATATGTTTGGGTGGTGAAAATGTGTGTGTGTTTTTTTTTTTCTTAAGTGACTTTGAAAT

TTTAAATAACAATTTAAAACATTAAAATTTCTTATTATCTTGGTCATTTAAACCTGC
Translation
 - UNI19064 - - UNI31689 - MPYVDRQNRICGFLDIEENENSGKFLRRYFILDTREDSFVWYMDNPQ - UNI19064 - - UNI23799 -

 NLPSGSSRVGAIKLTYISK - UNI10418 - - UNI11720 - VPKQSDSQPASDSLSRQGDCGKKQVSYRTDIVGGVPIITPTQ KEEVNECGES

LDRNNLKRSQSHLPYFAPKPPSDSAVIKAGYCVKQGAV - UNI26112 - MKNWKRRYFQLDENTIGYFKSEL EKEPLRVIPLKEVHKVQECKQS S

DIMMRDNLFEIVTTSRTFYVQ - UNI19305 - ADSPEEMHSWIKAVSGAIVAQRGPGRSSSS - UNI22729 - EHSGWPSEPKFTVRPAGAAAT

ASHSPASRSHSLVSGCAMEKRGVYQSLAKVKPGNFKVQTVSPREPASKVTEQALLRPQSKNGPQGEDGEPVDLDDASLPVSDV
Transcript ENSMUST00000048180
Sequence
GCGCCGCTCCCGGCAGCTGGGTGCCTGAAGGAGCCGGGACCGCGGTGGCGCGGGTGCTCCGGGCGGAGGCCGCG - UNI19064 - - UNI31689 -

 TGTAATGTTCAAGCCCAGAAATGCCTTATGTGGATCGACAGAATCGCATCTGTGGATTTCTAGACATTGAAGAAAATGAGAACAGTGGGAAATTTCTTC

GACGGTATTTCATCCTGGATACCAGAGAAGACAGCTTTGTATGGTACATGGATAATCCACAG - UNI19064 - - UNI23799 - AACCTGCCTTC

AGGATCGTCACGGGTTGGAGCCATTAAACTTACCTACATTTCAAAG - UNI10418 - - UNI11720 - GTACCAAAGCAGTCAGACTCACAGCCG

GCCTCCGACAGCCTGAGTCGCCAAGGTGACTGTGGTAAGAAGCAAGTGTCTTACAGAACTGACATTGTTGGTGGTGTGCCCATCATCACGCCGACGCAG 

AAAGAAGAAGTAAACGAATGTGGTGAGAGTCTGGATAGAAACAATTTGAAACGGTCACAGAGCCATCTTCCTTACTTTGCTCCTAAGCCACCTTCAGACA

GTGCAGTTATCAAAGCTGGGTATTGTGTGAAGCAAGGAGCGGTG - UNI26112 - ATGAAAAACTGGAAGAGAAGATATTTTCAATTGGATGAAAAC

ACAATAGGCTACTTCAAATCTGAACTG GAGAAGGAACCTCTGCGGGTGATACCACTTAAAGAAGTGCACAAAGTCCAGGAGTGCAAACAGAG TGACAT

AATGATGAGGGACAACCTGTTTGAAATCGTGACGACATCTCGGACTTTCTATGTGCAG - UNI19305 - GCTGATAGCCCTGAAGAGATGCACAGTT

GGATTAAAGCAGTCTCTGGCGCCATCGTAGCACAGCGGGGACCTGGCAGGTCATCCTCTTCT - UNI22729 - GAGCATTCCGGCTGGCCTTCAGAA

CCCAAATTCACTGTCCGTCCTGCCGGGGCCGCAGCCACCGCCTCACATTCCCCAGCCTCTCGCAGCCACTCTCTGGTCTCAGGCTGTGCCATGGAGAAGC

GAGGAGTTTACCAATCTCTTGCCAAGGTCAAGCCAGGGAACTTCAAGGTCCAGACTGTCTCTCCAAGAGAGCCAGCTTCCAAAGTGACTGAACAGGCTTT

GCTCAGACCTCAGAGTAAAAACGGCCCTCAGGGAGAAGATGGCGAGCCAGTGGACTTAGATGACGCCAGCCTGCCAGTCAGCGATGTGTGAGGAGGCTCT

CGTGGGCTGCCTGCGCCACTCACCCTCAGTGTCCTTCCGTGAGGCTTCTCGCCAAAGATGATAGAGGGTGAATGATCTCAGTGCATATGTCATACTGCCT

TGTGGGTGGACTCTAAGTTGGCAAACCAAGGATTTAGGGAGTGGCCTAGTCAACATAATTCTTTAAGAAAGGAAGGAGAAAAGCTGTGTCCATAGTGACT

GTTTGAAGCTTTATATGTTTGGGTGGTGAAAATGTGTGTGTGTTTTTTTTTTTCTTAAGTGACTTTGAAATTTTAAATAACAATTTAAAACATTAAAATT

TCTTATTATCTTGGTCATTTAAACCTGCTAATATGACTCCCTTTGAAATATTCAATATTTACACATTCTTATCAGCTAAAATTATCAAGTGGGCCATTCC

CAGATGAAAATTTCTAATCTCATGAGGTCTGTGGTGCTGCAGAATTTATACTGCAATGTGGACTGTTTAGAATTCTAACCATTTATGATATTCTGGCTGT

CCAGGTGAGTGGAAATTTTTGCATAGATTTGACTAGATGATTGGTGTAGGTGGCAGTGGAACAGGGCAAGCAGAAGTGGGGAGACTGGAGGTCAGCTATA

GCTAAAATTGTTATTTCTCTGGGGAGGGGACTTTTTTTATCTTTATTTTTATTTTGGAGATTGGATTTTTCTATGTAGCTATGGCTGTCCTTGAATTCTC

TCTGTAAACCAGGCTGCCCTTGAACTTGTGATCCTTCTGCCTCAGTTGCCTCCCAAATTATAGGGTTATGTCACCAACTTGCAGCCTGAGACACTTGTTT

TAAAAAGCTCAGTGTTTTATTTCAGTAAAAATTATTTGGTCATAAATTTTGGGAAGAACTGATTTCTTTTTTTAAATCAAAGTTTTGTAAATAGATCTTA

CTTCTGAATTTGAATCGGTGGAAGACCTCAGTTCACATGCTAAGTCAAAACGGCCCTTAGTCACGACCTTGTTGTGGCCCCTCCCTTGTCATCAGTAGTA

ACCTATACTCAAGTGCCTGTGTCTTCTCATCTCACTTAGGATTGTACCCCAAAGTCCTACATGATTGGCTTTAAATGTCCGGGAAAACTAATTTCAGTAG

CGTAGTTTGATAGGTTAAATGAGATAGCATTTTTATATCAGAGACACCAGAATGTTGGTGGTCAACTACCTGTGCAATATTTATGTCTTGAAAACCAGAT

CTGAGTATGCATTGAACAGTGGGGATATTATAAACAGAAGCGCCTCTCTGAAGAACCCGGTTTCCGGTGTTGAGTGATAGACTGGTTTGAGCGAGTACTG

TTTTGTGGTGACATCTTAGGTGTTTCCTTTCTCCCAGGCTGCTGCTCTGTGGTATTTCCAGTCTCAGACTTGTGTTGTGGAGTCATGGTGTTAGTGTTCT

GCCTTTTTATGTTCTAAGACTACTTGTTAGAGGACGGAAGATTTGCTACAGTGGTCTAGAGTTAAAATGTGCTCTTTAGTTGCCCAGCACAAGAACGTAC

CACTCACCTTTTGTATTCATAAGCTAATATGTTAGAGTTCTATGTAGTTTTCTCTTGTGCACCTGCATCAGAAAACCATAGGACAACAAGGTGGCTAGGC

AGTTATCACCCCTCTGCTGCCGTATTCATCACCCAGGCTCTCTTACAAGTTCCTTGTTAATGCACAAGCGTAGGGACCCTTGTACAGACTCTGGCAGTAT

TGATGAGCCTGGCGCTGTTTGCTTTGGTGCAGCCTCCACAGTGCGCGTTCATTTTATCATATTTTGGTATCGGTAATTTGATATATTTCATGGTGGCAAA

ATATTAGCTCTATTTTGGGACTTTTTCTAGACTTACATTTATTCAAATGCATAGGAATATGTCCTTGTGATTATCAGGATCTCCTAATATTTATCTCAAT

TCTTTTGTAAGCTTGTGGAAATTATTTAAGTATTTTAAAGCATATTTTCTTGTAAATATATCCTATCCGAAGTGTCAGCAGTTACGTTAGTTAATACCGT

GTTATCTGCTGTATTTTCCCTGTGTGTATAATGTATCTCCTTTCAGAACAGGAATGTGCCTCCTAATGTTTACTGTTACCCTGCTGTCTCTGTATGTCCA

GTCGGTGGAACACTGTAATGACTTGAGAATAAACTGCCCAGAGTTCA
Translation
 - UNI19064 - - UNI31689 - MPYVDRQNRICGFLDIEENENSGKFLRRYFILDTREDSFVWYMDNPQ - UNI19064 - - UNI23799 -

 NLPSGSSRVGAIKLTYISK - UNI10418 - - UNI11720 - VPKQSDSQPASDSLSRQGDCGKKQVSYRTDIVGGVPIITPTQ KEEVNECGES

LDRNNLKRSQSHLPYFAPKPPSDSAVIKAGYCVKQGAV - UNI26112 - MKNWKRRYFQLDENTIGYFKSEL EKEPLRVIPLKEVHKVQECKQS S

DIMMRDNLFEIVTTSRTFYVQ - UNI19305 - ADSPEEMHSWIKAVSGAIVAQRGPGRSSSS - UNI22729 - EHSGWPSEPKFTVRPAGAAAT

ASHSPASRSHSLVSGCAMEKRGVYQSLAKVKPGNFKVQTVSPREPASKVTEQALLRPQSKNGPQGEDGEPVDLDDASLPVSDV
Transcript ENSMUST00000075181
Sequence
GGGCCGTCGTGGGCGCCGCTCCCGGCAGCTGGGTGCCTGAAGGAGCCGGGACCGCGGTGGCGCGGGTGCTCCGGGCGGAGGCCGCGGTAAAGTGGGGCAT

GAG - UNI19064 - - UNI31689 - TGTAATGTTCAAGCCCAGAAATGCCTTATGTGGATCGACAGAATCGCATCTGTGGATTTCTAGACATTGA

AGAAAATGAGAACAGTGGGAAATTTCTTCGACGGTATTTCATCCTGGATACCAGAGAAGACAGCTTTGTATGGTACATGGATAATCCACAG - UNI190

64 - - UNI23799 - AACCTGCCTTCAGGATCGTCACGGGTTGGAGCCATTAAACTTACCTACATTTCAAAG GTTAGCGATGCAACTAAGTTAAGG

CCAAAGGCAGAGTTTTGTTTTG - UNI10418 - TTATGAATGCAGGAATGAGAAAATACTTTCTACAAGCTAATGATCAGCAGGACTTAGTGGAGTG

GGTAAATGTCTTGAACAAAGCTATAAAAATTACA - UNI11720 - GTACCAAAGCAGTCAGACTCACAGCCGGCCTCCGACAGCCTGAGTCGCCAAG

GTGACTGTGGTAAGAAGCAAGTGTCTTACAGAACTGACATTGTTGGTGGTGTGCCCATCATCACGCCGACGCAG AAAGAAGAAGTAAACGAATGTGGTG

AGAGTCTGGATAGAAACAATTTGAAACGGTCACAGAGCCATCTTCCTTACTTTGCTCCTAAGCCACCTTCAGACAGTGCAGTTATCAAAGCTGGGTATTG

TGTGAAGCAAGGAGCGGTG - UNI26112 - ATGAAAAACTGGAAGAGAAGATATTTTCAATTGGATGAAAACACAATAGGCTACTTCAAATCTGAAC

TG GAGAAGGAACCTCTGCGGGTGATACCACTTAAAGAAGTGCACAAAGTCCAGGAGTGCAAACAGAG TGACATAATGATGAGGGACAACCTGTTTGAA

ATCGTGACGACATCTCGGACTTTCTATGTGCAG - UNI19305 - GCTGATAGCCCTGAAGAGATGCACAGTTGGATTAAAGCAGTCTCTGGCGCCAT

CGTAGCACAGCGGGGACCTGGCAGGTCATCCTCTTCT ATGCGGCAGGCCAGAAGGCTGTCGAACCCTTGTATACAGAG - UNI22729 - GAGCATT

CCGGCTGGCCTTCAGAACCCAAATTCACTGTCCGTCCTGCCGGGGCCGCAGCCACCGCCTCACATTCCCCAGCCTCTCGCAGCCACTCTCTGGTCTCAGG

CTGTGCCATGGAGAAGCGAGGAGTTTACCAATCTCTTGCCAAGGTCAAGCCAGGGAACTTCAAGGTCCAGACTGTCTCTCCAAGAGAGCCAGCTTCCAAA

GTGACTGAACAGGCTTTGCTCAGACCTCAGAGTAAAAACGGCCCTCAGGGAGAAGATGGCGAGCCAGTGGACTTAGATGACGCCAGCCTGCCAGTCAGCG

ATGTGTGAGGAGGCTCTCGTGGGCTGCCTGCGCCACTCACCCTCAGTGTCCTTCCGTGAGGCTTCTCGCCAAAGATGATAGAGGGTGAATGATCTCAGTG

CATATGTCATACTGCCTTGTGGGTGGACTCTAAGTTGGCAAACCAAGGATTTAGGGAGTGGCCTAGTCAACATAATTCTTTAAGAAAGGAAGGAGAAAAG

CTGTGTCCATAGTGACTGTTTGAAGCTTTATATGTTTGGGTGGTGAAAATGTGTGTGTGTTTTTTTTTTTCTTAAGTGACTTTGAAATTTTAAATAACAA

TTTAAAACATTAAAATTTCTTATTATCTTGGTCATTTAAACCTGC
Translation
 - UNI19064 - - UNI31689 - MPYVDRQNRICGFLDIEENENSGKFLRRYFILDTREDSFVWYMDNPQ - UNI19064 - - UNI23799 -

 NLPSGSSRVGAIKLTYISK VSDATKLRPKAEFCFV - UNI10418 - VMNAGMRKYFLQANDQQDLVEWVNVLNKAIKIT - UNI11720 - VP

KQSDSQPASDSLSRQGDCGKKQVSYRTDIVGGVPIITPTQ KEEVNECGESLDRNNLKRSQSHLPYFAPKPPSDSAVIKAGYCVKQGAV - UNI26112

 - MKNWKRRYFQLDENTIGYFKSEL EKEPLRVIPLKEVHKVQECKQS SDIMMRDNLFEIVTTSRTFYVQ - UNI19305 - ADSPEEMHSWIKAV

SGAIVAQRGPGRSSSS MRQARRLSNPCIQR - UNI22729 - RSIPAGLQNPNSLSVLPGPQPPPHIPQPLAATLWSQAVPWRSEEFTNLLPRSSQG

TSRSRLSLQESQLPK
Transcript ENSMUST00000120441
Sequence
TTCCTTTGCCCGCCACGCCGCCGGGCGTGCGCGGAGCCTGTCGGGACTTGTAGTGTTCGCGGTAGGGAGTGCCCGCTCCGGAATCTCAGTCGCTGTCTGG

TCTGGTAGAGGCAGCGCGTGCACGCGTGCGCAGTGCGCGGGCGGGCCGTCGTGGGCGCCGCTCCCGGCAGCTGGGTGCCTGAAGGAGCCGGGACCGCGGT

GGCGCGGGTGCTCCGGGCGGAGGCCGCG - UNI19064 - - UNI31689 - TGTAATGTTCAAGCCCAGAAATGCCTTATGTGGATCGACAGAATC

GCATCTGTGGATTTCTAGACATTGAAGAAAATGAGAACAGTGGGAAATTTCTTCGACGGTATTTCATCCTGGATACCAGAGAAGACAGCTTTGTATGGTA

CATGGATAATCCACAG - UNI19064 - - UNI23799 - AACCTGCCTTCAGGATCGTCACGGGTTGGAGCCATTAAACTTACCTACATTTCAAAG

 GTTAGCGATGCAACTAAGTTAAGGCCAAAGGCAGAGTTTTGTTTTG - UNI10418 - TTATGAATGCAGGAATGAGAAAATACTTTCTACAAGCTA

ATGATCAGCAGGACTTAGTGGAGTGGGTAAATGTCTTGAACAAAGCTATAAAAATTACA - UNI11720 - GTACCAAAGCAGTCAGACTCACAGCCG

GCCTCCGACAGCCTGAGTCGCCAAGGTGACTGTGGTAAGAAGCAAGTGTCTTACAGAACTGACATTGTTGGTGGTGTGCCCATCATCACGCCGACGCAG 

AAAGAAGAAGTAAACGAATGTGGTGAGAGTCTGGATAGAAACAATTTGAAACGGTCACAGAGCCATCTTCCTTACTTTGCTCCTAAGCCACCTTCAGACA

GTGCAGTTATCAAAGCTGGGTATTGTGTGAAGCAAGGAGCGGTG - UNI26112 - ATGAAAAACTGGAAGAGAAGATATTTTCAATTGGATGAAAAC

ACAATAGGCTACTTCAAATCTGAACTG GAGAAGGAACCTCTGCGGGTGATACCACTTAAAGAAGTGCACAAAGTCCAGGAGTGCAAACAGAG TGACAT

AATGATGAGGGACAACCTGTTTGAAATCGTGACGACATCTCGGACTTTCTATGTGCAG - UNI19305 - GCTGATAGCCCTGAAGAGATGCACAGTT

GGATTAAAGCAGTCTCTGGCGCCATCGTAGCACAGCGGGGACCTGGCAGGTCATCCTCTTCT ATGCGGCAGGCCAGAAGGCTGTCGAACCCTTGTATAC

AGAGGTATACATCAAGAGCTGGTGAATGCAGCACGTATGTGGGCTCTCATGCAAATGTGCCTTCTTAGTAGAAGGCCTGGACTCGCTCCTCCTTACAGCT

GATCATAGAAG - UNI22729 - GAGCATTCCGGCTGGCCTTCAGAACCCAAATTCACTGTCCGTCCTGCCGGGGCCGCAGCCACCGCCTCACATTCC

CCAGCCTCTCGCAGCCACTCTCTGGTCTCAGGCTGTGCCATGGAGAAGCGAGGAGTTTACCAATCTCTTGCCAAGGTCAAGCCAGGGAACTTCAAGGTCC

AGACTGTCTCTCCAAGAGAGCCAGCTTCCAAAGTGACTGAACAGGCTTTGCTCAGACCTCAGAGTAAAAACGGCCCTCAGGGAGAAGATGGCGAGCCAGT

GGACTTAGATGACGCCAGCCTGCCAGTCAGCGATGTGTGAGGAGGCTCTCGTGGGCTGCCTGCGCCACTCACCCTCAGTGTCCTTCCGTGAGGCTTCTCG

CCAAAGATGATAGAGGGTGAATGATCTCAGTGCATATGTCATACTGCCTTGTGGGTGGACTCTAAGTTGGCAAACCAAGGATTTAGGGAGTGGCCTAGTC

AACATAATTCTTTAAGAAAGGAAGGAGAAAAGCTGTGTCCATAGTGACTGTTTGAAGCTTTATATGTTTGGGTGGTGAAAATGTGTGTGTGTTTTTTTTT

TTCTTAAGTGACTTTGAAATTTTAAATAACAATTTAAAACATTAAAATTTCTTATTATCTTGGTCATTTAAACCTGCTAATATGACTCCCTTTGAAATAT

TCAATATTTACACATTCTTATCAGCTAAAATTATCAAGTGGGCCATTCCCAGATGAAAATTTCTAATCTCATGAGGTCTGTGGTGCTGCAGAATTTATAC

TGCAATGTGGACTGTTTAGAATTCTAACCATTTATGATATTCTGGCTGTCCAGGTGAGTGGAAATTTTTGCATAGATTTGACTAGATGATTGGTGTAGGT

GGCAGTGGAACAGGGCAAGCAGAAGTGGGGAGACTGGAGGTCAGCTATAGCTAAAATTGTTATTTCTCTGGGGAGGGGACTTTTTTTATCTTTATTTTTA

TTTTGGAGATTGGATTTTTCTATGTAGCTATGGCTGTCCTTGAATTCTCTCTGTAAACCAGGCTGCCCTTGAACTTGTGATCCTTCTGCCTCAGTTGCCT

CCCAAATTATAGGGTTATGTCACCAACTTGCAGCCTGAGACACTTGTTTTAAAAAGCTCAGTGTTTTATTTCAGTAAAAATTATTTGGTCATAAATTTTG

GGAAGAACTGATTTCTTTTTTTAAATCAAAGTTTTGTAAATAGATCTTACTTCTGAATTTGAATCGGTGGAAGACCTCAGTTCACATGCTAAGTCAAAAC

GGCCCTTAGTCACGACCTTGTTGTGGCCCCTCCCTTGTCATCAGTAGTAACCTATACTCAAGTGCCTGTGTCTTCTCATCTCACTTAGGATTGTACCCCA

AAGTCCTACATGATTGGCTTTAAATGTCCGGGAAAACTAATTTCAGTAGCGTAGTTTGATAGGTTAAATGAGATAGCATTTTTATATCAGAGACACCAGA

ATGTTGGTGGTCAACTACCTGTGCAATATTTATGTCTTGAAAACCAGATCTGAGTATGCATTGAACAGTGGGGATATTATAAACAGAAGCGCCTCTCTGA

AGAACCCGGTTTCCGGTGTTGAGTGATAGACTGGTTTGAGCGAGTACTGTTTTGTGGTGACATCTTAGGTGTTTCCTTTCTCCCAGGCTGCTGCTCTGTG

GTATTTCCAGTCTCAGACTTGTGTTGTGGAGTCATGGTGTTAGTGTTCTGCCTTTTTATGTTCTAAGACTACTTGTTAGAGGACGGAAGATTTGCTACAG

TGGTCTAGAGTTAAAATGTGCTCTTTAGTTGCCCAGCACAAGAACGTACCACTCACCTTTTGTATTCATAAGCTAATATGTTAGAGTTCTATGTAGTTTT

CTCTTGTGCACCTGCATCAGAAAACCATAGGACAACAAGGTGGCTAGGCAGTTATCACCCCTCTGCTGCCGTATTCATCACCCAGGCTCTCTTACAAGTT

CCTTGTTAATGCACAAGCGTAGGGACCCTTGTACAGACTCTGGCAGTATTGATGAGCCTGGCGCTGTTTGCTTTGGTGCAGCCTCCACAGTGCGCGTTCA

TTTTATCATATTTTGGTATCGGTAATTTGATATATTTCATGGTGGCAAAATATTAGCTCTATTTTGGGACTTTTTCTAGACTTACATTTATTCAAATGCA

TAGGAATATGTCCTTGTGATTATCAGGATCTCCTAATATTTATCTCAATTCTTTTGTAAGCTTGTGGAAATTATTTAAGTATTTTAAAGCATATTTTCTT

GTAAATATATCCTATCCGAAGTGTCAGCAGTTACGTTAGTTAATACCGTGTTATCTGCTGTATTTTCCCTGTGTGTATAATGTATCTCCTTTCAGAACAG

GAATGTGCCTCCTAATGTTTACTGTTACCCTGCTGTCTCTGTATGTCCAGTCGGTGGAACACTGTAATGACTTGAGAATAAACTGCCCAGAGTTCATTTT

CACTCA
Translation
 - UNI19064 - - UNI31689 - MPYVDRQNRICGFLDIEENENSGKFLRRYFILDTREDSFVWYMDNPQ - UNI19064 - - UNI23799 -

 NLPSGSSRVGAIKLTYISK VSDATKLRPKAEFCFV - UNI10418 - VMNAGMRKYFLQANDQQDLVEWVNVLNKAIKIT - UNI11720 - VP

KQSDSQPASDSLSRQGDCGKKQVSYRTDIVGGVPIITPTQ KEEVNECGESLDRNNLKRSQSHLPYFAPKPPSDSAVIKAGYCVKQGAV - UNI26112

 - MKNWKRRYFQLDENTIGYFKSEL EKEPLRVIPLKEVHKVQECKQS SDIMMRDNLFEIVTTSRTFYVQ - UNI19305 - ADSPEEMHSWIKAV

SGAIVAQRGPGRSSSS MRQARRLSNPCIQRYTSRAGECSTYVGSHANVPS - UNI22729 - 

For any suggestions or comments, please send an email to unitrap@crg.es