Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040276 (Pacsin1)
Chromosomal location
Chr 17: 27792454 - 27848051 (+)
Description
protein kinase C and casein kinase substrate in neurons 1 Gene [Source:MGI (curated);Acc:Pacsin1-001]
RefSeq_dna
NM_011861 NM_178365 
RefSeq_peptide
NP_035991.1 NP_848142.1 
UniGene
Mm.4926 
MGI
MGI:1345181 
Uniprot/SWISSPROT
Q61644 
Uniprot/SPTREMBL
Q3TYF2 Q543Y7 
Human Ortholog
ENSG00000124507 (PACSIN1)
Omim not available
UniTrap UNI35125
Vector Insertion
Chr 17: 27822371 - 27838770
Public Clones IST10983G11 (tigm) IST14981F10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13070
Vector Insertion
Chr 17: 27839802 - 27841789
Public Clones CMHD-GT_344H8-3 (cmhd) IST13333B3 (tigm) IST12886F10 (tigm) IST14467E6 (tigm)
Private Clones OST277561 (lexicon) OST147587 (lexicon) OST119358 (lexicon)
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22691
Vector Insertion
Chr 17: 27842026 - 27842569
Public Clones not available
Private Clones OST287788 (lexicon)
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23066
Vector Insertion
Chr 17: 27842726 - 27842861
Public Clones not available
Private Clones OST277478 (lexicon) OST231699 (lexicon)
Severity of mutation (?) Insertion after 45% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114872
Sequence
CTCCTCCTCCTTTTCCTCCTCCTCCCCCGGGAAGCCGGCCGGGCTTGAGGCTGGGCCGCCGCCGCCGCCCGCTTTGCCACCCGCCCCGCTGATGGTGTCC

GGTGCTCCGGCGCCCAG - UNI35125 - CCTGTGAGCAGCAGGCCTGCTAACTGCAGATCCACAACCGCACAGCTCGCTACAGGTGCACCATGTCTG

GCTCCTACGATGAGGCCTCAGAGGAGATCACAGATAGCTTCTGGGAG GTGGGGAACTACAAGCGGACGGTGAAGCGCATCGACGATGGGCACCGCCTGT

GCAACGACCTCATGAGCTGCGTGCAGGAGCGCGCCAAGATCGAGAAGGCATACGCGCAGCAGCTCACCGACTGGGCCAAGCGCTGGCGCCAGCTCATCGA

GAAAG - UNI13070 - GTCCTCAGTATGGCAGCCTGGAGCGGGCGTGGGGCGCCATGATGACAGAAGCAGATAAGGTCAGCGAGCTGCACCAGGAGG

TGAAGAACAGCCTGCTGAATGAGGACCTGGAGAAAGTCAAGAACTGGCAGAAGGATGCCTATCACAAGCAGATCATGGGTGGCTTCAAGGAGACGAAAGA

GGCCGAGGATGGCTTCCGAAAGGCCCAGAAGCCCTGGGCTAAAAAGATGAAGGAG - UNI22691 - CTAGAGGCGGCCAAGAAGGCCTATCACTTGG

CTTGTAAGGAGGAAAGGCTGGCCATGACCCGGGAGATGAACAGTAAGACAGAGCAGTCGGTCACCCCTGAACAGCAGAAGAAACTTGTGGACAAAGTGGA

CAAATGCAGACAGGATGTGCAAAAG - UNI23066 - ACTCAGGAGAAGTATGAGAAGGTGCTGGAAGATGTGGGCAAGACCACACCACAGTACATGG

AGGGCATGGAGCAGGTGTTTGAGCAGTGCCAGCAGTTTGAGGAGAAGCGGCTGGTCTTCCTGAAGGAAGTCCTGCTGGATATCAAACGGCATCTCAACCT

AGCGGAGAACAGCAG CTACATGCATGTCTACCGAGAACTGGAGCAGGCCATCCGGGGGGCCGATGCCCAGGAGGACCTCAGGTGGTTCCGCAGCACCAG

TGGCCCCGGGATGCCCATGAACTGGCCGCAGTTCGAG GAGTGGAACCCAGACCTCCCGCACACCACTGCCAAGAAGGAGAAACAGCCTAAGAAGGCAGA

GGGGGCCACCCTGAGCAATGCCACTGGGGCTGTAGAATCCACATCCCAGGCTGGGGACCGTGGCAG TGTTAGCAGCTATGACCGAGGCCAAACATATGC

CACCGAGTGGTCAGACGATGAGAGCGGAAACCCCTTCGGGGGCAATGAGGCCAATGGTGGCGCCAACCCCTTCGAGGATGATGCCAAGGGAGTTCGTGTA

CGGGCACTCTATGACTACGACGGTCAGGAGCAGGATGAGCTCAGCTTCAAGGCCG GAGATGAGCTCACCAAGCTCGGAGAGGAAGACGAACAGGGTTGG

TGCCGCGGGCGGCTGGACAGCGGACAGCTGGGCCTCTATCCTGCCAACTACGTTGAGGCTATATAGCTACCTTGCCCACCCGACTCCTCTCAGTCCTTGT

CCACCGCCTTCCACCCTTCCCCTCCCCCTTGCCATAGAGTTCCAGACATATTTTCCGATCAAGCTTTTATTTTTTTAAAAGTCAAAACAGAACAAAAAAA

AAAAAAAA
Translation
 - UNI35125 - MSGSYDEASEEITDSFWE VGNYKRTVKRIDDGHRLCNDLMSCVQERAKIEKAYAQQLTDWAKRWRQLIEKG - UNI13070 - 

GPQYGSLERAWGAMMTEADKVSELHQEVKNSLLNEDLEKVKNWQKDAYHKQIMGGFKETKEAEDGFRKAQKPWAKKMKE - UNI22691 - LEAAKKA

YHLACKEERLAMTREMNSKTEQSVTPEQQKKLVDKVDKCRQDVQK - UNI23066 - TQEKYEKVLEDVGKTTPQYMEGMEQVFEQCQQFEEKRLVFL

KEVLLDIKRHLNLAENSS SYMHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFE EWNPDLPHTTAKKEKQPKKAEGATLSNATGAVESTSQAG

DRGS SVSSYDRGQTYATEWSDDESGNPFGGNEANGGANPFEDDAKGVRVRALYDYDGQEQDELSFKAG GDELTKLGEEDEQGWCRGRLDSGQLGLYPA

NYVEAI
Transcript ENSMUST00000045896
Sequence
TGACCTTCCTCCTTCCCGCAGCCCCAGAGAGACGCGCGGCGGTCGCGCCAGCCTTCTCCTCCTCCTTTTCCTCCTCCTCCCCCGGGAAGCCGGCCGGGCT

TGAGGCTGGGCCGCCGCCGCCGCCCGCTTTGCCACCCGCCCCGCTGATGGTGTCCGGTGCTCCGGCGCCCAG - UNI35125 - GGACACAGACCGGG

AGCAGGACCACTTCTCTCACCTCCGGATCTCTCCTGCTTCCGCAGCCTGTGAGCAGCAGGCCTGCTAACTGCAGATCCACAACCGCACAGCTCGCTACAG

GTGCACCATGTCTGGCTCCTACGATGAGGCCTCAGAGGAGATCACAGATAGCTTCTGGGAG GTGGGGAACTACAAGCGGACGGTGAAGCGCATCGACGA

TGGGCACCGCCTGTGCAACGACCTCATGAGCTGCGTGCAGGAGCGCGCCAAGATCGAGAAGGCATACGCGCAGCAGCTCACCGACTGGGCCAAGCGCTGG

CGCCAGCTCATCGAGAAAG - UNI13070 - GTCCTCAGTATGGCAGCCTGGAGCGGGCGTGGGGCGCCATGATGACAGAAGCAGATAAGGTCAGCGA

GCTGCACCAGGAGGTGAAGAACAGCCTGCTGAATGAGGACCTGGAGAAAGTCAAGAACTGGCAGAAGGATGCCTATCACAAGCAGATCATGGGTGGCTTC

AAGGAGACGAAAGAGGCCGAGGATGGCTTCCGAAAGGCCCAGAAGCCCTGGGCTAAAAAGATGAAGGAG - UNI22691 - CTAGAGGCGGCCAAGAA

GGCCTATCACTTGGCTTGTAAGGAGGAAAGGCTGGCCATGACCCGGGAGATGAACAGTAAGACAGAGCAGTCGGTCACCCCTGAACAGCAGAAGAAACTT

GTGGACAAAGTGGACAAATGCAGACAGGATGTGCAAAAG - UNI23066 - ACTCAGGAGAAGTATGAGAAGGTGCTGGAAGATGTGGGCAAGACCAC

ACCACAGTACATGGAGGGCATGGAGCAGGTGTTTGAGCAGTGCCAGCAGTTTGAGGAGAAGCGGCTGGTCTTCCTGAAGGAAGTCCTGCTGGATATCAAA

CGGCATCTCAACCTAGCGGAGAACAGCAG CTACATGCATGTCTACCGAGAACTGGAGCAGGCCATCCGGGGGGCCGATGCCCAGGAGGACCTCAGGTGG

TTCCGCAGCACCAGTGGCCCCGGGATGCCCATGAACTGGCCGCAGTTCGAG GAGTGGAACCCAGACCTCCCGCACACCACTGCCAAGAAGGAGAAACAG

CCTAAGAAGGCAGAGGGGGCCACCCTGAGCAATGCCACTGGGGCTGTAGAATCCACATCCCAGGCTGGGGACCGTGGCAG TGTTAGCAGCTATGACCGA

GGCCAAACATATGCCACCGAGTGGTCAGACGATGAGAGCGGAAACCCCTTCGGGGGCAATGAGGCCAATGGTGGCGCCAACCCCTTCGAGGATGATGCCA

AGGGAGTTCGTGTACGGGCACTCTATGACTACGACGGTCAGGAGCAGGATGAGCTCAGCTTCAAGGCCG GAGATGAGCTCACCAAGCTCGGAGAGGAAG

ACGAACAGGGTTGGTGCCGCGGGCGGCTGGACAGCGGACAGCTGGGCCTCTATCCTGCCAACTACGTTGAGGCTATATAGCTACCTTGCCCACCCGACTC

CTCTCAGTCCTTGTCCACCGCCTTCCACCCTTCCCCTCCCCCTTGCCATAGAGTTCCAGACATATTTTCCGATCAAGCTTTTATTTTTTTAAAAGTCAAA

ACAGAACAAAAAAAAAAAAAAAGAAGAAATACGAAGAGACAGCGTTTGCAGCCTACCTGGAGGCCGGGGGGGAGGGGGCTTAGGGTGATGGCCTCCCCCA

CAGCGTGGGCAAGGATCTTGGGACTTAACCCAATGTCACATCTGGTCTATAGAGTCCACCAAAGAGTCTCCTGAGTCTTGAGGGAGATCTTCTGGATCCT

TCTACCCTGTCTCGCTCTCCTATCCCACCACAGCTGCCAGCAGCTGCCCATGTCACCTGAGCCTGGCTTCCTAAACTCTCCTGTCCCCTCTCCTGTCCCC

CTTCAACGCCCCCTTCTCTTAAAGGGCCCCCAATCTTTAGTCTTCCACTCTGCCCTGGGGGTGCTTTTCTCTTCCCAGCCCTGTCCTAGTGAGGCTGGGG

GAGAAGGCTGCGGAGGGGAGGGGAGTGTCTCTTCACTCCCCCAGACATGAAGGCAGGTGAGTGGGAGGGAGTCATGGCCTCCCTGGCATACAGGAGAGGA

AGAAGGAGAACAGACCATCTGACCAGGCTGTGCCAACACTCCCAATGCCAAGCCCATTTTGAGGGATGAAAACCCTAGCTGGGCCTGTGGGCAGAGGGCT

CCTCCTCAGAGCCAATGAGCATTTGCAGAGACCCTACCTGTCTCTTTAGTCCTTGGCAATGGGCAAAGCCTCTTCCTTGGAAAGTCCAGGGCAAAGCCAG

CAACAGTAGCAACCTCCTCTCACTCTGGGGAGGAGGCATTGGCCACCCATCCCCCTCCCTTCATGGTCATTCAGAAACGCCACAGCCCCTCCCATCCCCA

ATCACTGTGTCAGCATCAGCCTTTGTGAAGACGGTCTACAAGGCTCTCACCTGGCCAACCTAGGAGATTCAGGGGCTCAGGAACCTAGGAGATTCAGGGG

CTTGGGGAACCTCCACCTTGGCACTGTAAGGGGAAGCCAGCAGCTCAGGCTGGTGTGAGGAAGGAACTCTGGATGGTCACTGTAGCTTTCTTCCTTGACC

TTTTAGTCCCCAACATCCCCTCTGAATGCTGGCAGCACCCCCACCCCCACACACACACTCCCATTTCTCTAAGCCCGAGAGTCTTGAGTCTTCATTAAAG

GATTCTGGGTGTGGGAGGGGACACAGGGCCCTTGTGGTTGGGAAGCAGGTGGCAGGCTCTCCCTTGGGAGGATGGGGTGGGAAACGAAACAGGTCAACCA

AGACCTCTTACAGTGGAAAGTGGTCAGAGGCTGTTTCTTTGGACCTTTGGGAACACAGATTTGAGAAAGTCTCATATTCACAGCTGGTGTCCGCTAGGCC

TCTGGCCTACGGACACCCTCTGCCTTGTGAATCAGGTGACCTTTTGGGCCTCCAGGGAAAGAACAGGACCACCATCCATGTTCTCCGGGACCCTTTAGCT

CTCTGCTGCTTCTCCTGACACTCAGGTCATGGACCCAAGCTTTGGGGTCCTGACCACCGCCCCCCCCCACCCCCCTTCTCTTGACTAGGCTGCAGCAGGG

CCTTCTGTTGGGTCAGTCCTCCCTCAGGGCCAGGAGCAGGAACTTAGCACTCAAGAGACAGGGCTGTAAGCACCCACTTCCCTGTCACTGTTTGCCCTTG

GGGCTTCAGCTGCAGCCCAGGTTGGGCCCTGGAGCCCTCAGAACCGGAAGCAGGATTCAAACCTCCCCTTCTCCACAGCCCCCCCTGCCTCCCCAGATGG

TAGACATCCCCCAGCTCTTACCTTCACCCTCATCTCAGAAAGGCAAGAAGCCGCCATGTCCGCACCTTGGGGCCTGGGCTTCCCCCTCTCTGTGCCAGCG

GCTTCCCAGCACCTGGGGAGGGGCTGTGGCCCTGACCAGACCCCAGGCCCACCCCACATAGTATACTAGCTGCCCACTCTGGGGCAGGAACTGGAAAATC

CATCCCTTTTGAACAACCACCTTCAATGACCCCCCCCATCTGGGACCAGACTTGGTCCTCAAGTTATTCAGCACCCCCAGTGCAGGAGGGTCCTCCCCCC

ACCCCCCGAAGTCCCTGGAGCCCGGAGCAGAGCCCCACCTGTGATTCCTGGTGTTAGGGCACCTCAAACCTTGGGCTGGACCACACCCCTTCCCGCCATT

TCCAGACCCCTACCTGTACTCCCCAGTGCTCCCCAGGGGCCTCTTGATGCTGCACGGGACCCTGCAGGGCTCGGTCAGTGATGTGTTTTGTCCCCAGTTA

ACCGCCATCCAGCGACCTGGTTCCAGGAGGAGCTCAGGTCACCCCCACCACCGCCGCCACTGCGTCTGCCGCCCTAGGCTTTCAGACATCATTAGTTCCG

ACACTTGTGAAACTCCGAGACGTGCCGTGGTCTCAGCAATGCACCTGTTTTATACATGATTGTGTAATTTAAAGGTATATAAATACAAATATATATATTA

TATCTATATCTATCAGTTGTGACCGTATGGCTGTCGATAAAACCAGAATTC
Translation
 - UNI35125 - MSGSYDEASEEITDSFWE VGNYKRTVKRIDDGHRLCNDLMSCVQERAKIEKAYAQQLTDWAKRWRQLIEKG - UNI13070 - 

GPQYGSLERAWGAMMTEADKVSELHQEVKNSLLNEDLEKVKNWQKDAYHKQIMGGFKETKEAEDGFRKAQKPWAKKMKE - UNI22691 - LEAAKKA

YHLACKEERLAMTREMNSKTEQSVTPEQQKKLVDKVDKCRQDVQK - UNI23066 - TQEKYEKVLEDVGKTTPQYMEGMEQVFEQCQQFEEKRLVFL

KEVLLDIKRHLNLAENSS SYMHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFE EWNPDLPHTTAKKEKQPKKAEGATLSNATGAVESTSQAG

DRGS SVSSYDRGQTYATEWSDDESGNPFGGNEANGGANPFEDDAKGVRVRALYDYDGQEQDELSFKAG GDELTKLGEEDEQGWCRGRLDSGQLGLYPA

NYVEAI
Transcript ENSMUST00000114873
Sequence
GTCGCCATTGGCTCACGGAGAAGCCGCTCTAATCCGCGCCGCCTCCGCCCCCGCGCGGCGCTGCGCTCGGCGGAGTCTCTGACCTTCCTCCTTCCCGCAG

CCCCAGAGAGACGCGCGGCGGTCGCGCCAGCCTTCTCCTCCTCCTTTTCCTCCTCCTCCCCCGGGAAGCCGGCCGGGCTTGAGGCTGGGCCGCCGCCGCC

GCCCGCTTTGCCACCCGCCCCGCTGATGGTGTCCGGTGCTCCGGCGCCCAG - UNI35125 - TTTGAGGCTCATCCCAGGGAACCTGCCTTCTCCAG

GGACACAGACCGGGAGCAGGACCACTTCTCTCACCTCCGGATCTCTCCTGCTTCCGCAGCCTGTGAGCAGCAGGCCTGCTAACTGCAGATCCACAACCGC

ACAGCTCGCTACAGGTGCACCATGTCTGGCTCCTACGATGAGGCCTCAGAGGAGATCACAGATAGCTTCTGGGAG GTGGGGAACTACAAGCGGACGGTG

AAGCGCATCGACGATGGGCACCGCCTGTGCAACGACCTCATGAGCTGCGTGCAGGAGCGCGCCAAGATCGAGAAGGCATACGCGCAGCAGCTCACCGACT

GGGCCAAGCGCTGGCGCCAGCTCATCGAGAAAG - UNI13070 - GTCCTCAGTATGGCAGCCTGGAGCGGGCGTGGGGCGCCATGATGACAGAAGCA

GATAAGGTCAGCGAGCTGCACCAGGAGGTGAAGAACAGCCTGCTGAATGAGGACCTGGAGAAAGTCAAGAACTGGCAGAAGGATGCCTATCACAAGCAGA

TCATGGGTGGCTTCAAGGAGACGAAAGAGGCCGAGGATGGCTTCCGAAAGGCCCAGAAGCCCTGGGCTAAAAAGATGAAGGAG - UNI22691 - CTA

GAGGCGGCCAAGAAGGCCTATCACTTGGCTTGTAAGGAGGAAAGGCTGGCCATGACCCGGGAGATGAACAGTAAGACAGAGCAGTCGGTCACCCCTGAAC

AGCAGAAGAAACTTGTGGACAAAGTGGACAAATGCAGACAGGATGTGCAAAAG - UNI23066 - ACTCAGGAGAAGTATGAGAAGGTGCTGGAAGAT

GTGGGCAAGACCACACCACAGTACATGGAGGGCATGGAGCAGGTGTTTGAGCAGTGCCAGCAGTTTGAGGAGAAGCGGCTGGTCTTCCTGAAGGAAGTCC

TGCTGGATATCAAACGGCATCTCAACCTAGCGGAGAACAGCAG CTACATGCATGTCTACCGAGAACTGGAGCAGGCCATCCGGGGGGCCGATGCCCAGG

AGGACCTCAGGTGGTTCCGCAGCACCAGTGGCCCCGGGATGCCCATGAACTGGCCGCAGTTCGAG GAGTGGAACCCAGACCTCCCGCACACCACTGCCA

AGAAGGAGAAACAGCCTAAGAAGGCAGAGGGGGCCACCCTGAGCAATGCCACTGGGGCTGTAGAATCCACATCCCAGGCTGGGGACCGTGGCAG TGTTA

GCAGCTATGACCGAGGCCAAACATATGCCACCGAGTGGTCAGACGATGAGAGCGGAAACCCCTTCGGGGGCAATGAGGCCAATGGTGGCGCCAACCCCTT

CGAGGATGATGCCAAGGGAGTTCGTGTACGGGCACTCTATGACTACGACGGTCAGGAGCAGGATGAGCTCAGCTTCAAGGCCG GAGATGAGCTCACCAA

GCTCGGAGAGGAAGACGAACAGGGTTGGTGCCGCGGGCGGCTGGACAGCGGACAGCTGGGCCTCTATCCTGCCAACTACGTTGAGGCTATATAGCTACCT

TGCCCACCCGACTCCTCTCAGTCCTTGTCCACCGCCTTCCACCCTTCCCCTCCCCCTTGCCATAGAGTTCCAGACATATTTTCCGATCAAGCTTTTATTT

TTTTAAAAGTCAAAACAG
Translation
 - UNI35125 - MSGSYDEASEEITDSFWE VGNYKRTVKRIDDGHRLCNDLMSCVQERAKIEKAYAQQLTDWAKRWRQLIEKG - UNI13070 - 

GPQYGSLERAWGAMMTEADKVSELHQEVKNSLLNEDLEKVKNWQKDAYHKQIMGGFKETKEAEDGFRKAQKPWAKKMKE - UNI22691 - LEAAKKA

YHLACKEERLAMTREMNSKTEQSVTPEQQKKLVDKVDKCRQDVQK - UNI23066 - TQEKYEKVLEDVGKTTPQYMEGMEQVFEQCQQFEEKRLVFL

KEVLLDIKRHLNLAENSS SYMHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFE EWNPDLPHTTAKKEKQPKKAEGATLSNATGAVESTSQAG

DRGS SVSSYDRGQTYATEWSDDESGNPFGGNEANGGANPFEDDAKGVRVRALYDYDGQEQDELSFKAG GDELTKLGEEDEQGWCRGRLDSGQLGLYPA

NYVEAI
Transcript ENSMUST00000097360
Sequence
AGAGCGCGCCGGAGGGGACCCCGAGAACCGAGCCCCAATCCAGACGCCAGACGCCTCCCGCCCTGCCCGCTGCCACGGAGCAGGTGACCAGCCAGCCCGT

CCGACCCTGGTTTGGCCCAGCGGGGGCAGTAAGCGCCCACCTGTCCCCTGCTTGGTGCCCAGCCCGGCTCAG - UNI35125 - GGACACAGACCGGG

AGCAGGACCACTTCTCTCACCTCCGGATCTCTCCTGCTTCCGCAGCCTGTGAGCAGCAGGCCTGCTAACTGCAGATCCACAACCGCACAGCTCGCTACAG

GTGCACCATGTCTGGCTCCTACGATGAGGCCTCAGAGGAGATCACAGATAGCTTCTGGGAG GTGGGGAACTACAAGCGGACGGTGAAGCGCATCGACGA

TGGGCACCGCCTGTGCAACGACCTCATGAGCTGCGTGCAGGAGCGCGCCAAGATCGAGAAGGCATACGCGCAGCAGCTCACCGACTGGGCCAAGCGCTGG

CGCCAGCTCATCGAGAAAG - UNI13070 - GTCCTCAGTATGGCAGCCTGGAGCGGGCGTGGGGCGCCATGATGACAGAAGCAGATAAGGTCAGCGA

GCTGCACCAGGAGGTGAAGAACAGCCTGCTGAATGAGGACCTGGAGAAAGTCAAGAACTGGCAGAAGGATGCCTATCACAAGCAGATCATGGGTGGCTTC

AAGGAGACGAAAGAGGCCGAGGATGGCTTCCGAAAGGCCCAGAAGCCCTGGGCTAAAAAGATGAAGGAG - UNI22691 - CTAGAGGCGGCCAAGAA

GGCCTATCACTTGGCTTGTAAGGAGGAAAGGCTGGCCATGACCCGGGAGATGAACAGTAAGACAGAGCAGTCGGTCACCCCTGAACAGCAGAAGAAACTT

GTGGACAAAGTGGACAAATGCAGACAGGATGTGCAAAAG - UNI23066 - ACTCAGGAGAAGTATGAGAAGGTGCTGGAAGATGTGGGCAAGACCAC

ACCACAGTACATGGAGGGCATGGAGCAGGTGTTTGAGCAGTGCCAGCAGTTTGAGGAGAAGCGGCTGGTCTTCCTGAAGGAAGTCCTGCTGGATATCAAA

CGGCATCTCAACCTAGCGGAGAACAGCAG CTACATGCATGTCTACCGAGAACTGGAGCAGGCCATCCGGGGGGCCGATGCCCAGGAGGACCTCAGGTGG

TTCCGCAGCACCAGTGGCCCCGGGATGCCCATGAACTGGCCGCAGTTCGAG GAGTGGAACCCAGACCTCCCGCACACCACTGCCAAGAAGGAGAAACAG

CCTAAGAAGGCAGAGGGGGCCACCCTGAGCAATGCCACTGGGGCTGTAGAATCCACATCCCAGGCTGGGGACCGTGGCAG TGTTAGCAGCTATGACCGA

GGCCAAACATATGCCACCGAGTGGTCAGACGATGAGAGCGGAAACCCCTTCGGGGGCAATGAGGCCAATGGTGGCGCCAACCCCTTCGAGGATGATGCCA

AGGGAGTTCGTGTACGGGCACTCTATGACTACGACGGTCAGGAGCAGGATGAGCTCAGCTTCAAGGCCG GAGATGAGCTCACCAAGCTCGGAGAGGAAG

ACGAACAGGGTTGGTGCCGCGGGCGGCTGGACAGCGGACAGCTGGGCCTCTATCCTGCCAACTACGTTGAGGCTATATAGCTACCTTGCCCACCCGACTC

CTCTCAGTCCTTGTCCACCGCCTTCCACCCTTCCCCTCCCCCTTGCCATAGAGTTCCAGACATATTTTCCGATCAAGCTTTTATTTTTTTAAAAGTCAAA

ACAG
Translation
 - UNI35125 - MSGSYDEASEEITDSFWE VGNYKRTVKRIDDGHRLCNDLMSCVQERAKIEKAYAQQLTDWAKRWRQLIEKG - UNI13070 - 

GPQYGSLERAWGAMMTEADKVSELHQEVKNSLLNEDLEKVKNWQKDAYHKQIMGGFKETKEAEDGFRKAQKPWAKKMKE - UNI22691 - LEAAKKA

YHLACKEERLAMTREMNSKTEQSVTPEQQKKLVDKVDKCRQDVQK - UNI23066 - TQEKYEKVLEDVGKTTPQYMEGMEQVFEQCQQFEEKRLVFL

KEVLLDIKRHLNLAENSS SYMHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFE EWNPDLPHTTAKKEKQPKKAEGATLSNATGAVESTSQAG

DRGS SVSSYDRGQTYATEWSDDESGNPFGGNEANGGANPFEDDAKGVRVRALYDYDGQEQDELSFKAG GDELTKLGEEDEQGWCRGRLDSGQLGLYPA

NYVEAI

For any suggestions or comments, please send an email to unitrap@crg.es