Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040282 (BC052040)
Chromosomal location
Chr 2: 115407512 - 115604504 (+)
Description
Uncharacterized protein C15orf41 homolog  [Source:UniProtKB/Swiss-Prot;Acc:Q3U4G0]
RefSeq_peptide
NP_997147.2 
UniGene
Mm.134929 
MGI
MGI:3026886 
Uniprot/SWISSPROT
Q3U4G0 
Uniprot/SPTREMBL
B1AY51 
Human Ortholog
ENSG00000186073 (C15orf41)
Omim not available
UniTrap UNI7003
Vector Insertion
Chr 2: 115407722 - 115456740
Public Clones RRZ260 (baygenomics)
Private Clones OST353100 (lexicon) OST118477 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21955
Vector Insertion
Chr 2: 115456787 - 115457671
Public Clones not available
Private Clones OST312953 (lexicon) OST77538 (lexicon)
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6234
Vector Insertion
Chr 2: 115457737 - 115464739
Public Clones CSG446 (baygenomics)
Private Clones OST84500 (lexicon)
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21556
Vector Insertion
Chr 2: 115464801 - 115468399
Public Clones not available
Private Clones OST326123 (lexicon)
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30256
Vector Insertion
Chr 2: 115468473 - 115495317
Public Clones D057H12 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33482
Vector Insertion
Chr 2: 115512906 - 115602637
Public Clones IST12030E8 (tigm) IST10905B5 (tigm) IST12580C3 (tigm) IST12073F6 (tigm)
IST11190G2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 85% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000110918
Sequence
GGATAGCTAAATAAGTGGAGGGCCCAGGGTCGTACCGCGCTCTGCCCTTCCCTAGGTTCTAGGCACCAAGCCCGCACGAGCCCAAGGGTGATTTTTCCTT

GGGCCCAATATGATACTAACCAAAGCCCAGTACGAGGAGATAGCCCAGTGCCTAGTGTCTGTACCGCCCACTAGGCAGAGCCTGAGGAAGCTGAAGCAGA

GGTTCCCCAG - UNI7003 - TCAATCGCAGGCCACTCTGCTGAGCATCTTCTCCCAGGAGTACCAG - UNI21955 - AAACATATTAAAAGAAC

ACATGCCAAACATCACACTCCAGAAGCGATTGAAAGTTACTACCAGAG - UNI6234 - GTACCTGAATGGCGTGGGGAAAAACGGAGCAGCCCCCGT

GCTCTTGGAGCTGGCCAATGAG - UNI21556 - GTGGACTATGCACCCTCATTAATGGCTCGGATTATCCTGGAGAGATTTCTACAGGGGCATGAAC

AGACTCCAC - UNI30256 - CCTCCAAGTCTGTTATAAACAGTATGCTGCGGGACCCTTCTCAGATTCCAGATGGAGTTCTAGCAAACCAGGTCTAT

CAG TGCATCGTGAATGACTGTTGCTATGGACCGCTGGTGGACTGCATCAAGCA CGCTATTGGCTATGAGCATGAAGTCCTGCTGAGAGACTTGCTTCT

GAAGAAAAACCTGTCGTTCCTAG ATGAGGATCAGCTCCGTGCAAAGGGCTATGACAAAACCCCAGACTTCATTTTACAGGTGCCAGTTG CTGTGGAAG

GGCACATAATTCACTGGATTGAAAGCAAAGCCTCATTTGGTGATGAATGTAGCCACCACGCCTACCTGCATGGCCAATTCTGGAGCTACTGGAATAG - 

UNI33482 - GTTTGGACCAGGCCTGGTCATCTATTGGTATGGATTTATCCAGGAACTGGACTGCAACCGGGAAAGAGGCATCCTGCTCAAAGCCTCGT

TCCCCACAGACATCGTCACCTTATGCCATAGCACAGCTTGACCCCGAAGATCCTGGAAGAGAAGCCGGAAGCAATGTTACTTTCCTGCAGTATAAACTGC

TGGCAGCATCTGCCCTGAACTTGAGATGAACCCTTGCTGCCGTCGCAGCCCTACCTCTAGACAAACATATCAGGAGTTTCTGTTTTCCTTCATCCCTGGG

TGATGTGAATAGCCAAGAACTGCAGACACAACCCACTCATTATCAGCATTTCTGTCTCTGACAAACAGTTAGTTTATAGATAGTCATAATCTTGCTTCCT

TCCGAATGCTTTCTCCTTGTATACTGAACAGAAGAGAAAGTATGGAGACTGCAAGATGTGAGTTTTCACTTCTCCTCCCTGTGATCAAATATTTTTTCTT

CTAACCCTCCATTCATATTCTCTCTCTCTCTCTCTCTCTCCCTCTCTCTCTCTCTCTCTCTCTCATATTCTCTCTCCCCCTCCCCACCCCACCCCCGGTC

TCTTGGCGGGTACACTGGTACTGAGTGTTGCATTACCGGGGAATAACCTAGCACAATCCTAGAAAAGCTGGAGACAGGAAGTCCGTAAGTAAATGTTCCT

TCTCACCTGGGGCTCAGCAGAGGCCGCCCGGAGTCTTTCTGTGGAGCCTGGTGGCCTCCTGACTTCTGTGGCATTCAGCCAAGCTGCACAAGTCCCCCTC

GATGAGAATTTCCTCTTTTCATAAAGTTGATGTGAACACCAAACCCTTCACAAGGCTGACCTCCTCTTCAAGTATGAGTTGCCGCTGTGTCTGGAAAACC

ATGCTCCTCTAGCTGGGGGCTGCAGCAGAGGACTGCACCCCGGCCTCTGGTCTGCAGTGGCCCTCTAAAGCAGACTGGCGGCCGGCAGGAACAACCTTAG

CAGCTATCATTATGAGATTTTTTTTTAAAGTACATTCATACATACTGCTTTGAGTCTGCATTTTATACCACATAATTGTTTAATACTCAAATGATTCAGA

CATTATAAATAGTCAGCTTTGAATGAATTAAGTGTACCAGAAAAGTTCTTGAGTGATTTTTAAATAAGCAATATAAAAGAGATTTTGCATTTATTCGCTT

TCATTTCTTTAGTTTTATATACTGCAGACCAGGCTTCGGTCAGAAGCAAAACATCAATAAAATAATTATAAACCTATCTTTTGGGAAATTAAAAACTAAT

CTGCATCTCCCCAAAAAATGTATTTTGTAGAAAAAATTTGCCCCCATGCTTATAAAATGTAGCTTTTATAATGTTGAATAGATTTTAGAAACAAACACCG

TAACTCATACGTTGGTTGGATCCTTTTGTACCTGGTTAGTGAGAAACTTGGTCTGTTGCCTTCCTCCCAAGGGTCACAAGGGTGGCAGGTCCAAGACAGG

ATTTTCAGCTCTCCTGAGAGAGTACAGGAAATCACGGGAGAGAAGGTAGGGTTATGGGTAAGGCAGTGTCAGGCAAACGCCTGTTTCCACCTAGAATACA

GCGTGCAGGTTTGGCGTATGAAATAGATGATTGAAGACCGCTACTACATTGCCTGTATACACAGTTTAAAGAAAAACATTAAAATCTGGTTTCATGGCAT

GCCCTAAGTTACCAGTTTGGTTTGTTTGGGTTTGGTTTGGGGGCACGGGGGGAGCAGTAAATTACATGCACCTGCACAGATGTTGGCAGTCTTGCTAAAC

CCTTGTCAGAGATTTGCTTGTTCCAACATTAGCCTAATTTATGATGACCGTTCACTAATAAAAGGTGCTTTCGTTTGC
Translation
MILTKAQYEEIAQCLVSVPPTRQSLRKLKQRFPS - UNI7003 - SQSQATLLSIFSQEYQ - UNI21955 - KHIKRTHAKHHTPEAIESYYQR 

- UNI6234 - RYLNGVGKNGAAPVLLELANE - UNI21556 - VDYAPSLMARIILERFLQGHEQTPP - UNI30256 - PSKSVINSMLRDPS

QIPDGVLANQVYQ CIVNDCCYGPLVDCIKH HAIGYEHEVLLRDLLLKKNLSFLD DEDQLRAKGYDKTPDFILQVPVA AVEGHIIHWIESKASFGDE

CSHHAYLHGQFWSYWNR - UNI33482 - RFGPGLVIYWYGFIQELDCNRERGILLKASFPTDIVTLCHSTA

For any suggestions or comments, please send an email to unitrap@crg.es