Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040298 (Btbd16)
Chromosomal location
Chr 7: 137917583 - 137969411 (+)
Description
BTB (POZ) domain containing 16 Gene [Source:MGI Symbol;Acc:MGI:3045247]
RefSeq_peptide
NP_001074507.1 
UniGene
Mm.271550 
MGI
MGI:3045247 
Uniprot/SPTREMBL
Q8C2U9 
Human Ortholog
ENSG00000138152 (BTBD16)
Omim not available
UniTrap UNI27780
Vector Insertion
Chr 7: 137933851 - 137938822
Public Clones not available
Private Clones OST49441 (lexicon)
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36606
Vector Insertion
Chr 7: 137959322 - 137962531
Public Clones IST14257H9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 68% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000048453
Sequence
AGAAAGCCTGAAGCCTCAAGCTGAGATAACACCAGAACCCGGAACAGGAAGTCCTTAGAATCTGACTGCTGTTGCCATGGTACCCACAACTACCCCCAGG

AAGCCAAAGGCAGGCTCCCCCAGCAAAGCATCGCCGTAGGAGAAGGGGTGAGCCCCAGGTGTCATGAGAGCGTTCAAGATTCAGGCTCAGAAGGTGCCCA

GCCTCCAACTCTCCCTTGGTTCCGAGACCAGTGCAACCAGCACCCCTCTGCTTCACTCTCAACCTCTGTGACCGTCCCCGTGGGCAGCAGGACTGCAGAA

CT GTGCTCATCACTGTCCTGCTGTGTCATCTCCACTGTCATTCATGAAAATGTTGAATTCAGTAAGTGGATCCTTTCGCAAGAAGGCCGGTGACAGCAG

GTCTAGAGAG TGCAGGACTCGGCTGGAGCGCAGGATTGTTGGTGCAACCAACCGATGGCGTTTTCCCCAAGACCATTTCTGCGGAGACCTGTTGGCACT

CTCCCAGATGTGCAATGTTTTAAATGTAGATCTTGACGAAGCTCTGAAGAACCCAGACAG ATTATGTATCTCAAAATTCCAGAAGCTTTTCTCCGAAAA

TATCATGAACAGTGGCACCCAAAGCGGGGAAGCAG ACGTGATCCTTGAATGCCTCGGCTTCAAGTGGGAACTCCACCACCCTCAGATCTTTCAGTCTGG

GACCTTGGCCAAGCTCTACCTGACAGCCTTGATACAGAACATGAAAAGCTCCCAGAGGGAGCTGGACAAGGTTCAGAAAG CTCATCCATCCGGGAAGAT

CAAAAAAAGGTCCCCTGTAAAGAAGATCATCATTTCCATGAGGATCAATGACCCGGCAGTCACCAGAGTTG CCTTCGCCCTGGCCCTGAAGAACCTCTA

CATGAAGGAGGTGGAAATGACCGTGGACAATGTGCTGGGCGTGCTGGCTTCTGCTCACATCCTCCAGTTCAACCGACTATTTCAAAA - UNI27780 -

 GTGTGTCAACATGATGATGAACAGACTCGCACCAAGCACCATCAAGAACTTCTACTTGGCCGGCTGTAAG TACGAAGAAGAGCAGCTCACCATGGCCT

GTGAGAAGTGGCTGGCAATGAACCTGGTCCCTCTAGTGGGGACTCAGATCCACCTCCGACAGATCCCTGAACCTCTGCTGTACAAGGTGCTGAAGTCGCC

CAG GTTGTTCACCTTCAGTGAGTTCCATCTCCTGAAAACCTTACTCATGTGGGTTTACCTACAGATGAACTGCAAGGTTCAGATGGTCCCAATCCACGA

GACCATTTTGGCATTTTTTAACAG CTTTCCCAAGAAGTGCTGCTTCCTAGAACAGGATCCAGGACAGAACTGGATGCCACTCTTCCTTTGCCTGCGTCT

GCACGGCATCACCAGTG - UNI36606 - GCAAGGATCTGGAGGTGTTGAAGCACATTAATTTCTTCCCTGAGTCCTGGCTGGTCCGGGTTACAGCCA

ACCATTACCACGCA CTGGAGAGCGGGGGCAACATGGTCCACCTGAAAGATCTTTCCACACAGGCCATGAGGTTCGGGCTGCTCTTTAGGCAG GAATAC

ACCACTTACTCGGAAAGGATTTCTATATACGGATACTTCTTTGAGATAAAGGGAATCAAACACGACCCTACCTCTTACAGTTTTTCTATGCAG AGAATA

AAACATACAGACTTGGAGTGCCCCTCACCAGTCTGTGAGCACAGTACCATCAGCTTGAGGTCGGAGCGCCTGGTGAAGTATGAGATCCAAGCCCAGACGC

TGGTGGACGGCAGGTGGCAGGAGTTCAGGACCAACCAAATCATGCAAAAGTTTGGGTTTATCAAGCCAGGCTGCAAAAGCCAC GTCTTGAAAATCCAAA

CCGTGGGCATCCCGATCTACGCCAGCTTTGCCTTCATCTTCCCAGCATCTTGATAGCTTTCATAGGAATCTATGGGATCCCCTTCCCTGGCCGGCCTGAC

TTCATAAGAGAAATAAAAATGACATTAAGGAGGGGAGCACTGTGTCCGGCTGCCTGAGCGCGTCAGCTCCCCTGGGTCGTCGGCTCAGGCATTAGAGTTT

AGTGCCAATCTGCTTCCGTTTTCATCTGAAGATAAGATTGGGAAAATTCACATTTAAGCTCACTCGGTCTGTTGACAGGCTAATCTTCTTGCAGATGCCT

GACCAAGGACCTTAGCAGCTACTAATTGTTTCACACAATGATCTGCAGACCTAAGATATCCCTTCCCCTCTGGTTTCGAAGTTAAGTCACACACTGCACC

CTTTCCTAAGAGAGAGGACTGTACAAAGGGTCACCTTTGTCCACCCCTCCGTGATGCCAGTTTTCTTTGAGAACCTGGAGAGTTGGTAGAGTTATGAAGA

CAGTCAGGTGGGTACGTCCAGCCTACCTAATGTCTGGTGTGGGATGGCACACAGCTGAGGGAGTCTTCCTTCCAACAGAGAATCTCAGGAGGTTAGAAGG

GCTGGTAGGACCGTGGGAGGTGGGCCTGGGAGAAGAATCAGCGCCAAAGCACTGGGCTTTGGGAGCCTGCTTCCAGAACCACTTCTTCCTCCTGTGTCCC

ACTCTTCTATGCTGTTGCTCCCACTCAAGACCAGTAAAAGAGAAGTAGTCGTGGGAGCTAGAGAGACAGGAGAGGAGAGAAATTGGGATAGCTATCACCT

CTCTGGGTTCATGGGCATCTTTCTGCAGTGACTGTGTCCCTTTGTGGCCCCAGCTTTCTCTGATCCTTCCTTCCATTTGCTACCCTGAAGTTTCCTTCCA

TCCTTCCAGGGTCCAACACAGGGCCTGTCCTTGCTCTGATATTAGCCACCTACCAGCCTTCAAGTGATGGAGGCATCTGCCAAGGCTGCAGTCCTGGGCT

GCATCAATCTCCTGTGCTTGACCAACTAGATCTCGCTTCATCATTATATCTGGGTCTCCATATTCTGTTTACTCTGCTTCAACTGTCTGGGTTTTGGGGG

TTTTGTTTGTTTGGGTTTTTTTTTTTTTAATGTTTTCCAGGTTACATAGGAATGGTTTGGTAGTGTTGGAGACACATATGACACAGTGCAATAGATATTG

GAAAACATGGCCTCCATAATTCACATTAGTGTGAGGACCAGTGAGACACTCAGGTACAAATTATATGAAGTATCAAAGCCCCATAATGGTCAGTGTGATG

GTTTGTATATGCTCTGCCCAGGGAGTGGCACTATTAGAAGGTGTGGCCCTGTTGAAGTAGGTGTGTCACTGTGGGTGTGGGCTTTAAGACCCTCAACCTA

GCTGCCTGGAAGTCAGTTTTCTGCTAGCAGCCTTCAGATGAAGACGATGAAGATGTAGAACTCTCAGCTCCTCCTGCACCATGCCTGCTTGGATGCTGCC

ATGTTCCCGCCTTGATAATAATGGACTGAACCTCTGAACCTGTAAGCCAGCCCCAATTAAATGTTATCCTTCT
Translation
 MKMLNSVSGSFRKKAGDSRSRE CRTRLERRIVGATNRWRFPQDHFCGDLLALSQMCNVLNVDLDEALKNPDR RLCISKFQKLFSENIMNSGTQSGEA

D DVILECLGFKWELHHPQIFQSGTLAKLYLTALIQNMKSSQRELDKVQKA AHPSGKIKKRSPVKKIIISMRINDPAVTRVA AFALALKNLYMKEVEM

TVDNVLGVLASAHILQFNRLFQK - UNI27780 - KCVNMMMNRLAPSTIKNFYLAGCK YEEEQLTMACEKWLAMNLVPLVGTQIHLRQIPEPLLYK

VLKSPR RLFTFSEFHLLKTLLMWVYLQMNCKVQMVPIHETILAFFNS SFPKKCCFLEQDPGQNWMPLFLCLRLHGITSG - UNI36606 - GKDLE

VLKHINFFPESWLVRVTANHYHA LESGGNMVHLKDLSTQAMRFGLLFRQ EYTTYSERISIYGYFFEIKGIKHDPTSYSFSMQ RIKHTDLECPSPVCE

HSTISLRSERLVKYEIQAQTLVDGRWQEFRTNQIMQKFGFIKPGCKSH VLKIQTVGIPIYASFAFIFPAS

For any suggestions or comments, please send an email to unitrap@crg.es