Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040328 (Olfr56)
Chromosomal location
Chr 11: 48792391 - 48948889 (+)
Description
olfactory receptor 56 Gene [Source:MGI (curated);Acc:Olfr56-001]
Human Ortholog
not available
Omim not available
UniTrap UNI38235
Vector Insertion
Chr 11: 48900647 - 48931122
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000102785
Sequence
AGAACACAGAGAAGAGCCTTTCTGTGAACAACCCCTGAGTGACATAAGCCATGACCGAAGGTCCTCTGCACTGCTACCAGGAGACTATCTTTGATACCAC

AA GGCTCATTGCTTCAGACTTTCCTGAAGGAGGGCAGACCCGTGCCGTTGGTGGTGGCTGTGCTGTGGGCTGCAGTGAGAAACAGACCCGGTATTTTCT

ACTTCTTGGATCTG - UNI38235 - AGACAAGAAGGGTGACTTTGTAAGAGGTGGAAAGGCAAACACAATGGTGTCAAGAGCAGTGGGGAGAGGATG

TGTGAGTTAAACACCTTGAGAGAAGATGACAGTGGGATCTTGATCAGATTGAAGAACACAGCACTGCACACAGAATGATGAAGAAGAGGAGGAAAGAAAC

AAGACACCAGTCAGAGCAGCATAAGAGGAGGGGTGAACATCTCCTGTATCCCAATCTACTTCCTGGTAATCCAAGAGAACCTGGGACTGTTCATCATACA

GAACTGGGAACAAAACAACATACAGACCTGAACCTTTGTCTCTGTAGGGATACTTAGAGGCTCTATACCCACAGGGAACTTATGGGCACAGTGGCTTCCA

TCTCTTCAAAGGAGGAATTAAAGCCACATGGAAGTACGGTGCAGATAAAAATGGGGACAAGCGGAGTCTGCAGACACACCCAAGGTCCCCACAGGAATCT

CCACGGGATCTTAGGACCTCTG AAAGAACTGTGCCAAAGAACATCTCAAG TTGAGCCATCTTCACAGCTGCTGTCACTGAGGGCTCTTACTTGGTTTG

TTACCCAGGGAATCCTTCTGTCCTGAACAAGAGAAACTGGAAAAACA TTATGCTGGTCTTCACCGTGGCGCTCTGTGGAAATGTCCTCCTCATCCTACT

CATCTACACTGACCCCCGACTCCACACCCCCATGTACTTCTTCCTCAGTCAGCTCTCCCTCATGGACCTCATGCTGGTCTGTAACATTGTGCCAAAGATG

GCAGTCAACTTCCTGTCTGGCAGGAAGTCCATCTCTTTTGCCGGCTGTGGCATACAAATCGGATTTTTTGTCTCTCTTGTGGGATCAGAGGGTCTCTTGT

TAGGACTCATGGCTTATGATCGCTATGTGGCCATTAGCCACCCACTTCACTATCCCATTCTCATGAGCCAAAAGGTCTGTCTCCAGATTGCTGGAAGTTC

CTGGGCTTTTGGGATCCTTGATGGAATAATTCAGATGGTGGCAGCCATGAGCCTGCCCTACTGTGGCTCACGGTATATAGATCACTTCTTCTGTGAAGTG

CCGGCTTTACTGAAGCTGGCCTGTGCAGACACCTCCCTTTTCGACACCCTGCTCTTTGCTTGCTGTGTCTTTATGCTGCTTCTTCCTTTCTCGATCATTG

TGACTTCCTATGCTCGCATCTTGGGGGCTGTGCTCCGTATGCACTCTGCCCAGTCCCGAAAAAAGGCCCTGGCCACTTGTTCCTCCCACCTGACAGCTGT

CTCTCTCTTCTACGGGGCAGCAATGTTCATCTACCTGAGGCCAAGGCGATATCGCGCTCCTAGCCATGACAAAGTTGTCTCAATCTTCTACACAGTTCTT

ACTCCTATGCTCAACCCCCTCATTTATAGCTTGAGGAACAGGGAGGTGATGGGGGCACTGAGGAAAGGACTGGACCGCTGCAGGGTTGGCAGCCAACATT

GAAAAGCCATGGCCTAGTGCCTGGCTGTGTTGCCTGATGTTTGCCTATACATTGGTAAGGCATCTTTGTTTTGTGAATCTCTGTTTCTTTATAGATAAAA

CAGAATCACGACATGTCCCTTTACCACAAGGATTTTGAAGGGACCACTTCCAATGAATCTGAAACCCCATAGGGGAGCGTTGCTACACTATTCATGTCAT

TATTGATTGTTTGTAACATCCTTGAATTAAACTTACTCTATTTCTCAG
Translation
  - UNI38235 -    MLVFTVALCGNVLLILLIYTDPRLHTPMYFFLSQLSLMDLMLVCNIVPKMAVNFLSGRKSISFAGCGIQIGFFVSLVGSEGL

LLGLMAYDRYVAISHPLHYPILMSQKVCLQIAGSSWAFGILDGIIQMVAAMSLPYCGSRYIDHFFCEVPALLKLACADTSLFDTLLFACCVFMLLLPFSI

IVTSYARILGAVLRMHSAQSRKKALATCSSHLTAVSLFYGAAMFIYLRPRRYRAPSHDKVVSIFYTVLTPMLNPLIYSLRNREVMGALRKGLDRCRVGSQ

H
Transcript ENSMUST00000056759
Sequence
AGAACACAGAGAAGAGCCTTTCTGTGAACAACCCCTGAGTGACATAAGCCATGACCGAAGGTCCTCTGCACTGCTACCAGGAGACTATCTTTGATACCAC

AA GGCTCATTGCTTCAGACTTTCCTGAAGGAGGGCAGACCCGTGCCGTTGGTGGTGGCTGTGCTGTGGGCTGCAGTGAGAAACAGACCCGGTATTTTCT

ACTTCTTGGATCTG - UNI38235 - AGACAAGAAGGGTGACTTTGTAAGAGGTGGAAAGGCAAACACAATGGTGTCAAGAGCAGTGGGGAGAGGATG

TGTGAGTTAAACACCTTGAGAGAAGATGACAGTGGGATCTTGATCAGATTGAAGAACACAGCACTGCACACAGAATGATGAAGAAGAGGAGGAAAGAAAC

AAGACACCAGTCAGAGCAGCATAAGAGGAGGGGTGAACATCTCCTGTATCCCAATCTACTTCCTGGTAATCCAAGAGAACCTGGGACTGTTCATCATACA

GAACTGGGAACAAAACAACATACAGACCTGAACCTTTGTCTCTGTAGGGATACTTAGAGGCTCTATACCCACAGGGAACTTATGGGCACAGTGGCTTCCA

TCTCTTCAAAGGAGGAATTAAAGCCACATGGAAGTACGGTGCAGATAAAAATGGGGACAAGCGGAGTCTGCAGACACACCCAAGGTCCCCACAGGAATCT

CCACGGGATCTTAGGACCTCTGGTGAGTG TCATTTGTGTCTCCAGTTGAGCCATCTTCACAGCTGCTGTCACTGAGGGCTCTTACTTGGTTTGTTACCC

AGGGAATCCTTCTGTCCTGAACAAGAGAAACTGGAAAAACA TTATGCTGGTCTTCACCGTGGCGCTCTGTGGAAATGTCCTCCTCATCCTACTCATCTA

CACTGACCCCCGACTCCACACCCCCATGTACTTCTTCCTCAGTCAGCTCTCCCTCATGGACCTCATGCTGGTCTGTAACATTGTGCCAAAGATGGCAGTC

AACTTCCTGTCTGGCAGGAAGTCCATCTCTTTTGCCGGCTGTGGCATACAAATCGGATTTTTTGTCTCTCTTGTGGGATCAGAGGGTCTCTTGTTAGGAC

TCATGGCTTATGATCGCTATGTGGCCATTAGCCACCCACTTCACTATCCCATTCTCATGAGCCAAAAGGTCTGTCTCCAGATTGCTGGAAGTTCCTGGGC

TTTTGGGATCCTTGATGGAATAATTCAGATGGTGGCAGCCATGAGCCTGCCCTACTGTGGCTCACGGTATATAGATCACTTCTTCTGTGAAGTGCCGGCT

TTACTGAAGCTGGCCTGTGCAGACACCTCCCTTTTCGACACCCTGCTCTTTGCTTGCTGTGTCTTTATGCTGCTTCTTCCTTTCTCGATCATTGTGACTT

CCTATGCTCGCATCTTGGGGGCTGTGCTCCGTATGCACTCTGCCCAGTCCCGAAAAAAGGCCCTGGCCACTTGTTCCTCCCACCTGACAGCTGTCTCTCT

CTTCTACGGGGCAGCAATGTTCATCTACCTGAGGCCAAGGCGATATCGCGCTCCTAGCCATGACAAAGTTGTCTCAATCTTCTACACAGTTCTTACTCCT

ATGCTCAACCCCCTCATTTATAGCTTGAGGAACAGGGAGGTGATGGGGGCACTGAGGAAAGGACTGGACCGCTGCAGGGTTGGCAGCCAACATTGAAAAG

CCATGGCCTAGTGCCTGGCTGTGTTGCCTGATGTTTGCCTATACATTGGTAAGGCATCTTTGTTTTGTGAATCTCTGTTTCTTTATAGATAAAACAGAAT

CACGACATGTCCCTTTACCACAAGGATTTTGAAGGGACCACTTCCAATGAATCTGAAACCCCATAGGGGAGCGTTGCTACACTATTCATGTCATTATTGA

TTGTTTGTAACATCCTTGAATTAAACTTACTCTATTTCTCAG
Translation
  - UNI38235 -   MLVFTVALCGNVLLILLIYTDPRLHTPMYFFLSQLSLMDLMLVCNIVPKMAVNFLSGRKSISFAGCGIQIGFFVSLVGSEGLL

LGLMAYDRYVAISHPLHYPILMSQKVCLQIAGSSWAFGILDGIIQMVAAMSLPYCGSRYIDHFFCEVPALLKLACADTSLFDTLLFACCVFMLLLPFSII

VTSYARILGAVLRMHSAQSRKKALATCSSHLTAVSLFYGAAMFIYLRPRRYRAPSHDKVVSIFYTVLTPMLNPLIYSLRNREVMGALRKGLDRCRVGSQH


For any suggestions or comments, please send an email to unitrap@crg.es