Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040370 (Lyrm5)
Chromosomal location
Chr 6: 145159654 - 145165459 (+)
Description
LYR motif containing 5 Gene [Source:MGI (curated);Acc:Lyrm5-002]
RefSeq_dna
NM_133688 
RefSeq_peptide
NP_598449.1 
UniGene
Mm.397139 Mm.46847 
MGI
MGI:1914886 
Uniprot/SWISSPROT
Q91V16 
Uniprot/SPTREMBL
B2KFC1 
Human Ortholog
ENSG00000205707 (LYRM5)
Omim not available
UniTrap UNI15422
Vector Insertion
Chr 6: 145159997 - 145163041
Public Clones (sanger) PST4848-NR (escells) PST7097-NR (escells) IST14914A2 (tigm)
IST14913A9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27846
Vector Insertion
Chr 6: 145163041 - 145163066
Public Clones not available
Private Clones OST46115 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17814
Vector Insertion
Chr 6: 145163703 - 145163792
Public Clones not available
Private Clones OST436008 (lexicon) OST96007 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26102
Vector Insertion
Chr 6: 145163870 - 145164255
Public Clones not available
Private Clones OST137514 (lexicon) OST131478 (lexicon) OST104432 (lexicon)
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000111726
Sequence
GGCCGTGGTGCCGCAAAGCGCTGGAGTGAGGCGGTCTGAGCAAGCTGTCGTCTGGACCCCAGACCTGCTGGTGGTGAA - UNI15422 - - UNI178

14 - - UNI27846 - GTATATCATGTATAAAAGTGGATCAATTCCATGTTAAGTGAAAATGGCCAATTCGTTACGAGGAGAAGTACTGACTCTTTAT

AAAAAT - UNI17814 - - UNI26102 - CTGCTGTATCTTGGACGGGACTATCCAAAAGGAGCAGACTATTTTAAAAGGCGTTTGAAGAACGTTT

TCCTTAAAAACAAGGATGTGGAGGACCCAGAGAAGATCAAAGAACTTATCGCACGAGGAGAATTTGTAATGAAGGAGCTAGAGGCCTTGTACTTCCTTAG

GAAATACAGAGCTATGAAGCAACGTTACTATTCAGATACCAAAGTCTGACCAATCATTGCACCAGTCGAGCTGACAACCAGTGCTGGCTGTTTGCCTGTA

CCAACTATTAAAAAATAATTCAGTTTAAAAGGGTGAGATACATGGTTTTTAAAAAAATGAGTTGCCCTACTGTACTGAAATAGGTTTCAACCTTATTGAT

ACTGAGAGCTTTGCCCATAATCCTTTTATTACTGAAATAGTAACTTTAGTACCTTTCATGATAATATAATTTTGAAAGAAAATACACTTAATTTTTAAAC

ATGTTATAGCCAATTTTCTTAAGTCTATTTCTTCATTTACTGATGAGATTGTCACTATCGAATGGTGTCTGACAGGCTTGCCCTTTAGCTTCTAGAGTGT

CTTTGTCCTTGTTTTTTGTTGTTTTGTTAGCCCATCTAGTATACTAAAGTGCATATTCAAGGCTCTCTACAGACACCTCAAAATGATTTAAATGCAGTTA

TCAAAATAAGACATGTGAAGGTGACCTCTATCTTGAGAAGCTCAGTGGGTGACTAGCATTGTGTAGCTATTATTCCCATTATTCTTTGTGCTGCTGGCCT

GCCTTAAGTTCTGAACCACTTCAAGTAGCTTTCATGAGGAGTTGTAATGTTCCTCTATTTCTGCCATTAAAGCTGGTATATTTTCTGTCGACCTGTAACC

GAGTCCATGTGGCAGTGGACCTAACCCAGGCAGGACTGTAAGTTTAAGCAAAAATGTTTATGTAATGTTTTTAGCAACGTTATAAATAACATTTCTAACT

TAAAAGCTGCAAATAGTGTTGCTTATAGGATTCTGTATCAGGCTGGAGAGATGGCTCAGTGGTTAAGAGCACTGACTGCTCTTCCAGAGGTCCTGAATTT

AATTCCCAGCAACCATATGGTGGCTTACAACCATCTGTAATGGGATCTGATGTCCACTTCTGGTGTGTCTGAACACAGACAGTGTACTCATAGAATAAAT

AAATAAACGAATAAATCTT
Translation
 - UNI15422 - - UNI17814 - - UNI27846 - MANSLRGEVLTLYKN - UNI17814 - - UNI26102 - LLYLGRDYPKGADYFKRR

LKNVFLKNKDVEDPEKIKELIARGEFVMKELEALYFLRKYRAMKQRYYSDTKV
Transcript ENSMUST00000111725
Sequence
CTCAGCTCCGCCCACTTCCGGCAGACGGTCGGAGCATTTACGGCCGTGGTGCCGCAAAGCGCTGGAGTGAGGCGGTCTGAGCAAGCTGTCGTCTGGACCC

CAGACCTGCTGGTGGTGAAGTATGCCTTAGGCGAGGGCTTCCGGGCGTGGGGAGAGCTGCGTCTCACACTGAAACGCAGGCTGACCTGGAACTCGCGGGC

ATCCCTCAGCTTCCTCCTGAGAGCTGGGGTTATAGCCGAGGCCCGCCACGGCCAGCCTTGTAAAAAGGTTTCTTCCTCGCTTCTTTTGCGTCTGGACGAG

CCCTTCCCGGGGGATCTGGGGAATGGCGCCAGCTCACGACTAG - UNI15422 - - UNI17814 - - UNI27846 - GTATATCATGTATAAAA

GTGGATCAATTCCATGTTAAGTGAAAATGGCCAATTCGTTACGAGGAGAAGTACTGACTCTTTATAAAAAT - UNI17814 - - UNI26102 - CT

GCTGTATCTTGGACGGGACTATCCAAAAGGAGCAGACTATTTTAAAAGGCGTTTGAAGAACGTTTTCCTTAAAAACAAGGATGTGGAGGACCCAGAGAAG

ATCAAAGAACTTATCGCACGAGGAGAATTTGTAATGAAGGAGCTAGAGGCCTTGTACTTCCTTAGGAAATACAGAGCTATGAAGCAACGTTACTATTCAG

ATACCAAAGTCTGACCAATCATTGCACCAGTCGAGCTGACAACCAGTGCTGGCTGTTTGCCTGTACCAACTATTAAAAAATAATTCAGTTTAAAAGGGTG

AGATACATGGTTTTTAAAAAAATGAGTTGCCCTACTGTACTGAAATAGGTTTCAACCTTATTGATACTGAGAGCTTTGCCCATAATCCTTTTATTACTGA

AATAGTAACTTTAGTACCTTTCATGATAATATAATTTTG
Translation
 - UNI15422 - - UNI17814 - - UNI27846 - MANSLRGEVLTLYKN - UNI17814 - - UNI26102 - LLYLGRDYPKGADYFKRR

LKNVFLKNKDVEDPEKIKELIARGEFVMKELEALYFLRKYRAMKQRYYSDTKV
Transcript ENSMUST00000039729
Sequence
AGACGGTCGGAGCATTTACGGCCGTGGTGCCGCAAAGCGCTGGAGTGAGGCGGTCTGAGCAAGCTGTCGTCTGGACCCCAGACCTGCTGGTGGTGAA - 

UNI15422 - - UNI27846 - CTAAAGCACCGAGTCAAAAGCATGGTCAGCAGCATGGATGCTGTCTGCTCTGCCTCCCGTGGAACCTTTCCAAGTG

CTCCCTTTGCCCGCTGCCTCTTACTCTGCATTCTCCTTAAGGACCAACCTTCTTGATCTTGATCGAACAACCCAATTTATCTTAGTTTTAAAATTTCCTC

CAAGAATACTCTTCTAGATTTGGACTCTTAGTTTCTTCCAAATAATCAAGCCAAGCCTTGAGAGCAGGGCAGACAGCTTTACTTTTGGTAAGGAAAGCAG

GCTTAGAAAAGTGGTGTTACCCAGTGCCTCAATAAAACAGCTCAGTACAAATAACCATTTGGGGGGATAAGAAGTCTTAATGGCAAAGCACTTGCACAAA

CAAGAGGGTCCTGTAGACCTGCAAGTTTGTAATCCCAGTGTACATACAGGGGGGTGAGAGGTAGGAGAATCCCTAAATGAAGGAAGGGCCAGCTGTTTGC

AGCAACAACTAAGACCCGTGGAAAGGACTGACAGCTGAGGTCATCAGCTCCAAATGCACACTGGCAAGTACAAGTCTGTACACAAGAATGAAAAGCCAGC

TCACCAGCTCCATGGGAAGATCTCTGGTTCTTTAAGATTTACAATGCAGTTATTTGCAAAAAAAAGAAAATCTTCCTTTTCTTTAGGTATATCATGTATA

AAAGTGGATCAATTCCATGTTAAGTGAAAATGGCCAATTCGTTACGAGGAGAAGTACTGACTCTTTATAAAAAT - UNI17814 - - UNI26102 -

 CTGCTGTATCTTGGACGGGACTATCCAAAAGGAGCAGACTATTTTAAAAGGCGTTTGAAGAACGTTTTCCTTAAAAACAAGGATGTGGAGGACCCAGAG

AAGATCAAAGAACTTATCGCACGAGGAGAATTTGTAATGAAGGAGCTAGAGGCCTTGTACTTCCTTAGGAAATACAGAGCTATGAAGCAACGTTACTATT

CAGATACCAAAGTCTGACCAATCATTGCACCAGTCGAGCTGACAACCAGTGCTGGCTGTTTGCCTGTACCAACTATTAAAAAATAATTCAGTTTAAAAGG

GTGAGATACATGGTTTTTAAAAAAATGAGTTGCCCTACTGTACTGAAATAGGTTTCAACCTTATTGATACTGAGAGCTTTGCCCATAATCCTTTTATTAC

TGAAATAGTAACTTTAGTACCTTTCATGATAATATAATTTTGAAAGAAAATACACTTAATTTTTAAACATGTTATAGCCAATTTTCTTAAGTCTATTTCT

TCATTTACTGATGAGATTGTCACTATCGAATGGTGTCTGACAGGCTTGCCCTTTAGCTTCTAGAGTGTCTTTGTCCTTGTTTTTTGTTGTTTTGTTAGCC

CATCTAGTATACTAAAGTGCATATTCAAGGCTCTCTACAGACACCTCAAAATGATTTAAATGCAGTTATCAAAATAAGACATGTGAAGGTGACCTCTATC

TTGAGAAGCTCAGTGGGTGACTAGCATTGTGTAGCTATTATTCCCATTATTCTTTGTGCTGCTGGCCTGCCTTAAGTTCTGAACCACTTCAAGTAGCTTT

CATGAGGAGTTGTAATGTTCCTCTATTTCTGCCATTAAAGCTGGTATATTTTCTGTCGACCTGTAACCGAGTCCATGTGGCAGTGGACCTAACCCAGGCA

GGACTGTAAGTTTAAGCAAAAATGTTTATGTAATGTTTTTAGCAACGTTATAAATAACATTTCTAACTTAAAAGCTGCAAATAGTGTTGCTTATAGGATT

CTGTATCAGGCTGGAGAGATGGCTCAGTGGTTAAGAGCACTGACTGCTCTTCCAGAGGTCCTGAATTTAATTCCCAGCAACCATATGGTGGCTTACAACC

ATCTGTAATGGGATCTGATGTCCACTTCTGGTGTGTCTGAACACAGACAGTGTACTCATAGAATAAATAAATAAACGAATAAATCTTAAAGTCTTAAAGG

AGTCTTTATCAACTACCAAGCAGACATTTCCACCAAGAAATACCTATAGCCAGGATGGGGATGAGGCTCAGTGTTAAGTACTTGCCTAAGGAACACGTGA

GGCTCCAAAATTGAGCCTTAACCACAATTAAAACTACATAATTACACACTTCATAGTCACCATAACTATTTTTATTACATTACAATGATTAGGAGCAGTA

CGGTTCATGACAAAAATATTACAAATTTCAGATCACTTCACAGCACGTACTCCTATAAACATTTAAAAGTTAATTTTAATTAAGAGTGGTCACTTTTAAA

TTTAATGTTTGATATGACCAACATTCCCTAGGTCAGCGCAACCAAAGGATGGAAAACAACTGGATCACACTGCATATGTCCCATAACAAA
Translation
 - UNI15422 - - UNI27846 - MANSLRGEVLTLYKN - UNI17814 - - UNI26102 - LLYLGRDYPKGADYFKRRLKNVFLKNKDVED

PEKIKELIARGEFVMKELEALYFLRKYRAMKQRYYSDTKV
Transcript ENSMUST00000111724
Sequence
GGCCGTGGTGCCGCAAAGCGCTGGAGTGAGGCGGTCTGAGCAAGCTGTCGTCTGGACCCCAGACCTGCTGGTGGTGAA - UNI15422 - - UNI278

46 - CTAAAGCACCGAGTCAAAAGCATGGTCAGCAGCATGGATGCTGTCTGCTCTGCCTCCCGTGGAACCTTTCCAAGTGCTCCCTTTGCCCGCTGCCT

CTTACTCTGCATTCTCCTTAAGGACCAACCTTCTTGATCTTGATCGAACAACCCAATTTATCTTAGTTTTAAAATTTCCTCCAAGAATACTCTTCTAGAT

TTGGACTCTTAGTTTCTTCCAAATAATCAAGCCAAGCCTTGAGAGCAGGGCAGACAGCTTTACTTTTG - UNI17814 - GTATATCATGTATAAAAG

TGGATCAATTCCATGTTAAGTGAAAATGGCCAATTCGTTACGAGGAGAAGTACTGACTCTTTATAAAAAT - UNI17814 - - UNI26102 - CTG

CTGTATCTTGGACGGGACTATCCAAAAGGAGCAGACTATTTTAAAAGGCGTTTGAAGAACGTTTTCCTTAAAAACAAGGATGTGGAGGACCCAGAGAAGA

TCAAAGAACTTATCGCACGAGGAGAATTTGTAATGAAGGAGCTAGAGGCCTTGTACTTCCTTAGGAAATACAGAGCTATGAAGCAACGTTACTATTCAGA

TACCAAAGTCTGACCAATCATTGCACCAGTCGAGCTGACAACCAGTGCTGGCTGTTTGCCTGTACCAACTATTAAAAAATAATTCAGTTTAAAAGGGTGA

GATACATGGTTTTTAAAAAAATGAGTTGCCCTACTGTACTGAAATAGGTTTCAACCTTATTGATACTGAGAGCTTTGCCCATAATCCTTTTATTACTGAA

ATAGTAACTTTAGTACCTTTCATGATAATATAATTTTGAAAGAAAATACACTTAATTTTTAAACATGTTATAGCCAATTTTCTTAAGTCTATTTCTTCAT

TTACTGATGAGATTGTCACTATCGAATGGTGTCTGACAGGCTTGCCCTTTAGCTTCTAGAGTGTCTTTGTCCTTGTTTTTTGTTGTTTTGTTAGCCCATC

TAGTATACTAAAGTGCATATTCAAGGCTCTCTACAGACACCTCAAAATGATTTAAATGCAGTTATCAAAATAAGACATGTGAAGGTGACCTCTATCTTGA

GAAGCTCAGTGGGTGACTAGCATTGTGTAGCTATTATTCCCATTATTCTTTGTGCTGCTGGCCTGCCTTAAGTTCTGAACCACTTCAAGTAGCTTTCATG

AGGAGTTGTAATGTTCCTCTATTTCTGCCATTAAAGCTGGTATATTTTCTGTCGACCTGTAACCGAGTCCATGTGGCAGTGGACCTAACCCAGGCAGGAC

TGTAAGTTTAAGCAAAAATGTTTATGTAATGTTTTTAGCAACGTTATAAATAACATTTCTAACTTAAAAGCTGCAAATAGTGTTGCTTATAGGATTCTGT

ATCAGGCTGGAGAGATGGCTCAGTGGTTAAGAGCACTGACTGCTCTTCCAGAGGTCCTGAATTTAATTCCCAGCAACCATATGGTGGCTTACAACCATCT

GTAATGGGATCTGATGTCCACTTCTGGTGTGTCTGAACACAGACAGTGTACTCATAGAATAAATAAATAAACGAATAAATCTTAAA
Translation
 - UNI15422 - - UNI27846 -  - UNI17814 - MANSLRGEVLTLYKN - UNI17814 - - UNI26102 - LLYLGRDYPKGADYFKR

RLKNVFLKNKDVEDPEKIKELIARGEFVMKELEALYFLRKYRAMKQRYYSDTKV
Transcript ENSMUST00000111723
Sequence
GGCCGTGGTGCCGCAAAGCGCTGGAGTGAGGCGGTCTGAGCAAGCTGTCGTCTGGACCCCAGACCTGCTG - UNI15422 - - UNI27846 - CTA

AAGCACCGAGTCAAAAGCATGGTCAGCAGCATGGATGCTGTCTGCTCTGCCTCCCGTGGAACCTTTCCAAGTGCTCCCTTTGCCCGCTGCCTCTTACTCT

GCATTCTCCTTAAGGACCAACCTTCTTGATCTTGATCGAACAACCCAATTTATCTTAGTTTTAAAATTTCCTCCAAGAATACTCTTCTAGATTTGGACTC

TTAGTTTCTTCCAAATAATCAAGCCAAGCCTTGAGAGCAGGGCAGACAGCTTTACTTTTG - UNI17814 - GTATATCATGTATAAAAGTGGATCAA

TTCCATGTTAAGTGAAAATGGCCAATTCGTTACGAGGAGAAGTACTGACTCTTTATAAAAAT - UNI17814 - - UNI26102 - CTGCTGTATCT

TGGACGGGACTATCCAAAAGGAGCAGACTATTTTAAAAGGCGTTTGAAGAACGTTTTCCTTAAAAACAAGGATGTGGAGGACCCAGAGAAGATCAAAGAA

CTTATCGCACGAGGAGAATTTGTAATGAAGGAGCTAGAGGCCTTGTACTTCCTTAGGAAATACAGAGCTATGAAGCAACGTTACTATTCAGATACCAAAG

TCTGACCAATCATTGCACCAGTCGAGCTGACAACCAGTGCTGGCTGTTTGCCTGTACCAACTATTAAAAAATAATTCAGTTTAAAAGGGTGAGATACATG

GTTTTTAAAAAAATGAGTTGCCCTACTGTACTGAAATAGGTTTCAACCTTATTGATACTGAGAGCTTTGCCCATAATCCTTTTATTACTGAAATAGTAAC

TTTAGTACCT
Translation
 - UNI15422 - - UNI27846 -  - UNI17814 - MANSLRGEVLTLYKN - UNI17814 - - UNI26102 - LLYLGRDYPKGADYFKR

RLKNVFLKNKDVEDPEKIKELIARGEFVMKELEALYFLRKYRAMKQRYYSDTKV
Transcript ENSMUST00000111721
Sequence
CGCAAAGCGCTGGAGTGAGGCGGTCTGAGCAAGCTGTCGTCTGGACCCCAGACCTGCTG - UNI15422 - - UNI17814 - - UNI27846 - G

TATATCATGTATAAAAGTGGATCAATTCCATGTTAAGTGAAAATGGCCAATTCGTTACGAGGAGAAGTACTGACTCTTTATAAAAAT - UNI17814 -

 - UNI26102 - CTGCTGTATCTTGGACGGGACTATCCAAAAGGAGCAGACTATTTTAAAAGGCGTTTGAAGAACGTTTTCCTTAAAAACAAGGATGT

GGAGGACCCAGAGAAGATCAAAGAACTTATCGCACGAGGAGAATTTGTAATGAAGGAGCTAGAGGCCTTGTACTTCCTTAGGAAATACAGAGCTATGAAG

CAACGTTACTATTCAGATACCAAAGTCTGACCAATCATTGCACCAGTCGAGCTGACAACCAGTGCTGGCTGTTTGCCTGTACCAACTATTAAAAAATAAT

TCAGTTTAAAAGGGTGAGATACATGGTTTTTAAAAAAATGAGTTGCCCTACTGTACTGAAATAGGTTTCAACCTTATTGATACTGAGAGCTTTGCCCATA

ATCCTTTTATTACTGAAATAGTAACTTTAGTACCTTTCATGATAATATAATTTTGAAAGAAAATACACTTAATTTTTAAACATGTTATAGCCAATTTTCT

TAAGTCTATTTCTTCATTTACTGATGAGATTGTCACTATCGAATGGTGTCTGACAGGCTTGCCCTTTAGCTTCTAGAGTGTCTTTGTCCTTGTTTTTTGT

TGTTTTGTTAGCCCATCTAGTATACTAAAGTGCATATTCAAGGCTCTCTACAGACACCTCAAAATGATTTAAATGCAGTTATCAAAATAAGACATGTGAA

GGTGACCTCTATCTTGAGAAGCTCAGTGGGTGACTAGCATTGTGTAGCTATTATTCCCATTATTCTTTGTGCTGCTGGCCTGCCTTAAGTTCTGAACCAC

TTCAAGTAGCTTTCATGAGGAGTTGTAATGTTCCTCTATTTCTGCCATTAAAGCTGGTATATTTTCTGTCGACCTGTAACCGAGTCCATGTGGCAGTGGA

CCTAACCCAGGCAGGACTGTAAGTTTAAGCAAAAATGTTTATGTAATGTTTTTAGCAACGTTATAAATAACATTTCTAACTTAAAAGCTGCAAATAGTGT

TGCTTATAGGATTCTGTATCAGGCTGGAGAGATGGCTCAGTGGTTAAGAGCACTGACTGCTCTTCCAGAGGTCCTGAATTTAATTCCCAGCAACCATATG

GTGGCTTACAACCATCTGTAATGGGATCTGATGTCCACTTCTGGTGTGTCTGAACACAGACAGTGTACTCATAGAATAAATAAATAAACGAATAAATCTT

AAA
Translation
 - UNI15422 - - UNI17814 - - UNI27846 - MANSLRGEVLTLYKN - UNI17814 - - UNI26102 - LLYLGRDYPKGADYFKRR

LKNVFLKNKDVEDPEKIKELIARGEFVMKELEALYFLRKYRAMKQRYYSDTKV
Transcript ENSMUST00000111719
Sequence
GTGAGGCGGTCTGAGCAAGCTGTCGTCTGGACCCCAGACCTGCTGGTGGTGAA - UNI15422 - - UNI27846 - CTAAAGCACCGAGTCAAAAG

CATG - UNI27846 - GGCAGACAGCTTTACTTTTGGTAAGGAAAGCAGGCTTAGAAAAGTGGTGTTACCCAGTGCCTCAATAAAACAGCTCAGTACA

AATAACCATTTGGGGGGATAAGAAGTCTTAATGGCAAAGCACTTGCACAAACAAGAGGGTCCTGTAGACCTGCAAGTTTGTAATCCCAGTGTACATACAG

GGGGGTGAGAGGTAGGAGAATCCCTAAATGAAGGAAGGGCCAGCTGTTTGCAGCAACAACTAAGACCCGTGGAAAGGACTGACAGCTGAGGTCATCAGCT

CCAAATGCACACTGGCAAGTACAAGTCTGTACACAAGAATGAAAAGCCAGCTCACCAGCTCCATGGGAAGATCTCTGGTTCTTTAAGATTTACAATGCAG

TTATTTGCAAAAAAAAGAAAATCTTCCTTTTCTTTAGGTATATCATGTATAAAAGTGGATCAATTCCATGTTAAGTGAAAATGGCCAATTCGTTACGAGG

AGAAGTACTGACTCTTTATAAAAAT - UNI17814 - - UNI26102 - CTGCTGTATCTTGGACGGGACTATCCAAAAGGAGCAGACTATTTTAAA

AGGCGTTTGAAGAACGTTTTCCTTAAAAACAAGGATGTGGAGGACCCAGAGAAGATCAAAGAACTTATCGCACGAGGAGAATTTGTAATGAAGGAGCTAG

AGGCCTTGTACTTCCTTAGGAAATACAGAGCTATGAAGCAACGTTACTATTCAGATACCAAAGTCTGACCAATCATTGCACCAGTCGAGCTGACAACCAG

TGCTGGCTGTTTGCCTGTACCAACTATTAAAAAATAATTCAGTTTAAAAGGGTGAGATACATGGTTTTTAAAAAAATGAGTTGCCCTACTGTACTGAAAT

AGGTTTCAACCTTATTGATACTGAGAGCTTTGCCCA
Translation
 - UNI15422 - - UNI27846 -  - UNI27846 - MANSLRGEVLTLYKN - UNI17814 - - UNI26102 - LLYLGRDYPKGADYFKR

RLKNVFLKNKDVEDPEKIKELIARGEFVMKELEALYFLRKYRAMKQRYYSDTKV

For any suggestions or comments, please send an email to unitrap@crg.es