Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040383 (Aqr)
Chromosomal location
Chr 2: 113926911 - 114001055 (-)
Description
aquarius Gene [Source:MGI (curated);Acc:Aqr-001]
RefSeq_dna
NM_009702 
RefSeq_peptide
NP_033832.2 
UniGene
Mm.2545 
MGI
MGI:1276102 
Uniprot/SWISSPROT
Q8CFQ3 
Uniprot/SPTREMBL
A2AQA6 A2AQA7 
Human Ortholog
ENSG00000021776 (AQR)
Omim not available
UniTrap UNI17459
Vector Insertion
Chr 2: 113998484 - 114000827
Public Clones not available
Private Clones OST442404 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27226
Vector Insertion
Chr 2: 113987421 - 113991928
Public Clones not available
Private Clones OST66281 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1094
Vector Insertion
Chr 2: 113968845 - 113971363
Public Clones CE0138 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI120
Vector Insertion
Chr 2: 113960556 - 113962605
Public Clones GC0053 (tigem) W078A08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2876
Vector Insertion
Chr 2: 113944635 - 113945645
Public Clones AF0001 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1884
Vector Insertion
Chr 2: 113935791 - 113938217
Public Clones AY0688 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 81% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26158
Vector Insertion
Chr 2: 113927466 - 113929739
Public Clones not available
Private Clones OST133672 (lexicon) OST8955 (lexicon)
Severity of mutation (?) Insertion after 94% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000043160
Sequence
CCGGGACTTCTCAGGTTCCGGGAGGAACCGTGGGAGCCCAGCGTGTCTGTGCCGGGCGCTCTGGCACCTCGGGGCTGGGTCGCCGCCGCTGCTTGAAAGC

TTTCGAGAGTCGCCGCTACGAGCCTCTGGTCAGCTTCAGTGGCGATCGCTGCGATGGCGGCTCCTGCGCAGCCCAAGAAAATCGTGGCCCCCACGGTGTC

CCAGATCAACGCGGAGTTCGTCACTCAG - UNI17459 - CTAGCATGTAAATACTGGGCTCCTCATATCAAGAAGAAATCACCGTTTGATATAAAA 

GTAATTGAAGAAATATATGAAAAAGAGATCGTCAAATCACG GTTTGCCATCAGGAAAATAATGCTGCTGGAATTTAG - UNI27226 - CCAATACC

TTGAAAATTATCTTTGGATGAATTATTCTCCGGAAGTTTCCAGCAAGGCCTATTTAATGTCCATCTGCTGTATGGTGAATGAGAAGTTCAGAGAAAATGT

CCCAGCCTGGGAG ACCTTTAAGAAGAAACCAGACCACTTCCCATTCTTTTTTAAGTGCATCTTGAAAGCGGCCTTAGCTGAGACTGACGGCGAGTTCTC

CCTCCACGAGCAGACACTGCTCCTGCTTTTCCTGGATCACTGCTTCAATAGCTTG GAAGTAGACTTGATAAGGAGTCAGGTGCAGCAGCTTATCTCGCT

CCCGATGTGGATGGGCTTGCAGCCT GCACGATTGGAATTAGAATTGAAAAAGACACCAAAGCTAAGAAAATTCTGGAACCTGATTAAAAAGAATGATGA

AAAGATGGACCCAGAAGCAAGAGAGCA GGCCTACCAAGAAAGAAGGTTTCTCTCCCGGCTCATCCAGAAGTTCATCTCCGTGTTGAAGTCCATCCCGCT

TTCTG AGCCTGTCACCATGGACAAGGTTCATTACTGTGAAAGATTCATCGAACTGATGATTGATCTAGAG GCTCTACTCCCCACGAGGCGCTGGTTTA

ACACCATCCTGGATGACTCCCACCTTCTGGTTCACTGCTACCTCTCCAGTCTTGTTCACAGAGAAGAGGACGGCCATCTGTTTTCCCAG CTTTTAGACA

TGCTGAAGTTCTATACTGGCTTTGAGATTAACGACCAGACTGGAAATGCTCTGACAGAGAACGAGATGACCACGATTCACTATGACAGAATTACATCTCT

GCAG AGGGCTGCCTTCGCACACTTCCCCGAGCTCTATGACTTTGCCCTCTCCAATGTGGCAGAAGTAGATGCCCGAGATTCCTTGGTCAAGTTTTTTGG

GCCTCTCAG TTCAAACACACTCCACCAGGTGGCATCATACCTCTGCCTCTTGCCAACGCTCCCTAAAAATGAAGACACAACTTTTGATAAAGAGTTTCT

TCTAGAATTGCTG - UNI1094 - GTGTCTCGCCACGAACGCCGCATCTCTCAAATTCAGCAACTGAATCAGATGCCTTTGTATCCAACTGAGAAAAT

TATATGGGATGAGAACATCGTCCCTACTGAGTACTATTCTGGGGAAG GCTGCCTTGCTCTCCCCAAGTTGAATCTGCAGTTTTTGACTCTGCACGACTA

TCTCCTGAGGAACTTCAATCTCTTCCGCTTAGAGTCAACTTACGAAATTAGACAAGACATCGAGGACAGTGTCAGCAGAATGAAGCCCTG GCAGTCTGA

GTATGGTGGCGTAGTGTTCGGTGGTTGGGCACGGATGGCCCAGCCCATTGTGGCTTTCACTGTAGTCGAGGTTGCCAAACCCAACATCGGTGAAAACTGG

CCAACCCGAGTTCGTGCAGATGTCACCATCAATCTGAATGTCAGAGACCACATCAAGGATGAGTGGGAAG - UNI120 - GTCTTCGAAAGCACGATG

TATGCTTTTTAATTACTGTGCGTCCAACAAAACCTTACGGCACTAAGTTTGACAGGAGGAGACCTTTTATTGAGCAAGTTGGTCTGGTGTACGTCAGAGG

CTGTGAAATCCAGGGCATGCTGGATGACAAAGGGCGAGTCATCGAAGACG GACCTGAACCCAGACCCAATCTTAGAGGAGAGTCAAGGACATTTCGAGT

ATTTTTGGATCCAAACCAGTATCAACAGGATATGACCAATACGATACAAAACGGAGCCGAAGATGTGTATGACACTTTCAATGTCATAATGAGGAGGAAA

CCGAAGGAGAATAACTTCAAG GCTGTGTTGGAGACGATTCGGAATCTGATGAATACTGACTGCGTGGTACCGGACTGGCTGCATGACATCATTTTGGGC

TATGGGGACCCAAGTAGTGCCCATTATTCAAAAATGCCCAATCAGATTGCCACCCTGGATTTCAATGACACTTTTCTCTCCATTGAACATTTAAAGGCCA

GCTTTCCTGGTCATAATGTCAAAGTGACTGTGAGTGACCCAGCACTCCAAATCCCCCCTTTCAG AATAACGTTCCCAGTAAGAAGTGGAAAGGGGAAGA

AAAGAAAAGATGCAGACGGGGAAGAAGATGACACAGAAGAAGCAAAGACCTTAATTGTGGAGCCTCATGTTATTCCTAATAGAGGCCCTTATCCTTACAA

CCAGCCCAAACG TAATACAATCCAGTTCACTCATACACAGATAGAGGCCATCCGGGCCGGAATGCAGCCTGGACTCACCATG GTTGTGGGCCCACCTG

GTACAGGAAAAACAGATGTTGCAGTCCAGATCATATCCAACATTTACCACAATTTCCCAGAACAGAGGACTTTAATTGTTACTCATTCCAATCAG GCTC

TGAACCAGCTGTTTGAGAAAATCATGGCTTTAGACATTGATGAGCGCCATCTCCTGCGTCTGGGTCATGGAGAAGAAGAGCTAGAGACAGAGAAAGACTT

TAGCAG GTATGGAAGAGTTAATTATGTCCTAGCTCGAAGAATAGAACTTTTAGAAGAAGTCAAACGGTTACAAAAGAGTCTGGGGGTTCCCGGAGATGC

TTCGTATACCTGTGAAACTGCCGGCTATTTCTTCTTATATCAG - UNI2876 - GTGATGTCCCGCTGGGAAGAATACATGAGCAGAGTGAAGAACTC

GGGGACTGCCTGCCCGGACGCTGCCCCGGACGCTGCACAGGTCGCCACGTTCTTCCCCTTCCATGAGTATTTTGCCAATGCTCCTCAGCCCATCTTTAAA

GGCAGATCTTATGAGGAAGACATGGAAATCGCTGAAGGGTGCTTCAGGCACATTAAGAAAATCTTCACCCAACTTGAG GAGTTCAGAGCCTCGGAGCTG

CTTCGCAGTGGACTGGACAGATCCAAATACCTCTTGGTAAAAGAAGCCAAAATCATCGCTATGACATGTACTCATGCTGCCTTGAAACGACACGACTTGG

TCAAGTTGGGTTTCAAG TATGACAACATTTTAATGGAAGAGGCTGCTCAGATTCTGGAGATCGAAACCTTTATCCCTCTACTTCTGCAG AATCCTCAA

GACGGATTCAGCCGATTGAAACGGTGGATTATGATTGGCGATCACCACCAATTGCCTCCAGTCATTAAGAACATGGCCTTTCAGAAGTATTCCAACATGG

AGCAGTCTCTTTTCACTCGCTTCGTCCGGGTTGGAGTTCCTACTGTGGACCTTGATGCTCAAGGGAGAGCCAGGGCAAG CTTGTGTAACCTCTACAACT

GGCGCTACAAAAACCTAGGGAATTTGCCCCATGTGCAGCTCCTGCCAGAGTTCAGCACAGCCAACGCGGGCCTGCTGTATGACTTCCAGCTCATCAACGT

GGAAGACTTTCAGGGCGTGGGAGAGTCGGAGCCTAACCCTTACTTCTACCAG - UNI1884 - AACCTTGGAGAGGCAGAGTATGTAGTGGCGCTCTT

CATGTACATGTGCTTGCTTGGTTACCCTGCAGACAAGATCAGTATTCTAACAACCTACAATGGACAGAAGCATCTGATTCGGGACATCATCAATAGGCGC

TGTGGGAATAATCCACTGATTGGAAGGCCAAACAAA GTGACAACAGTTGACAGATTCCAGGGTCAGCAGAACGATTATATCCTCCTTTCGCTAGTGCGG

ACCAGGGCTGTGGGTCATCTGAG GGATGTGCGTCGCTTGGTGGTAGCCATGTCAAGAGCCAGGCTTGGCCTTTACATCTTCGCTCGAGTGTCCCTCTTC

CAGAACTGCTTTGAACTGACTCCTGCTTTCAGCCAGCTCACTGCCCGCCCACTGCATTTGCATATCATTCCAACAGAACCCTTCCCAACCTCCAGAAAG 

AATGGAGAGAGACCACCTCATGAAGTGCAGGTAATTAAGAACATGCCCCAGATGGCGAACTTTGTGTACAACATGTATATGCATCTGATACAGACTACCC

ATCATTATCATCAG - UNI26158 - ACTTTCTTACAACTGCCACCTGCCATGGTGGAAGAAGGTGAGGAAGGTCAGAGCCAAGAAACAGAAATGGAA

GCAGAAGAAGAAACCGTGTCTGCTCAAGGTAACCTCACACCCAGTCCAGCGGATGCCAGCCTGAGTCAAGAGACCCCAGCCGCTCAGCCTGACTGCTCCA

GTCAGACAGAAGACACCTCTGCCCCGTGTGACATTGCTACTGCAGCTGAGCCTGTCTCTGCAGCAGCAGAAGCTGCCACCCCACAAGATGCAGAGTCTGT

CCCCACAGAGACCGAGTAGCCTATCTGCAGCACAGCCTGGGACATTCCATTTATAAACTCTAAGTGAGGTTACCTTTTGAATTTCATACTTAGTTACTGT

ATGACTTTAATAACACCAGCTAATTTCAGTACTTATGGTTTTTAGCTGGTTTCCTTATTTTGTATATTTTTTATTTGTAAATATTAAAAATAACTCTAGT

TTCATTTGTTCATTCAGAAGAGAAAATAATTTTGATTGCTGAATGTATCTGAGGTAATCCCTGCATTAAAATCATTTTCTATC
Translation
MAAPAQPKKIVAPTVSQINAEFVTQ - UNI17459 - LACKYWAPHIKKKSPFDIK VIEEIYEKEIVKSR RFAIRKIMLLEFS - UNI27226 -

 SQYLENYLWMNYSPEVSSKAYLMSICCMVNEKFRENVPAWE TFKKKPDHFPFFFKCILKAALAETDGEFSLHEQTLLLLFLDHCFNSL EVDLIRSQV

QQLISLPMWMGLQP ARLELELKKTPKLRKFWNLIKKNDEKMDPEAREQ QAYQERRFLSRLIQKFISVLKSIPLSE EPVTMDKVHYCERFIELMIDLE

 ALLPTRRWFNTILDDSHLLVHCYLSSLVHREEDGHLFSQ LLDMLKFYTGFEINDQTGNALTENEMTTIHYDRITSLQ RAAFAHFPELYDFALSNVAE

VDARDSLVKFFGPLS SSNTLHQVASYLCLLPTLPKNEDTTFDKEFLLELL - UNI1094 - VSRHERRISQIQQLNQMPLYPTEKIIWDENIVPTEY

YSGEG GCLALPKLNLQFLTLHDYLLRNFNLFRLESTYEIRQDIEDSVSRMKPW WQSEYGGVVFGGWARMAQPIVAFTVVEVAKPNIGENWPTRVRADV

TINLNVRDHIKDEWEG - UNI120 - GLRKHDVCFLITVRPTKPYGTKFDRRRPFIEQVGLVYVRGCEIQGMLDDKGRVIEDG GPEPRPNLRGESRT

FRVFLDPNQYQQDMTNTIQNGAEDVYDTFNVIMRRKPKENNFK AVLETIRNLMNTDCVVPDWLHDIILGYGDPSSAHYSKMPNQIATLDFNDTFLSIEH

LKASFPGHNVKVTVSDPALQIPPFR RITFPVRSGKGKKRKDADGEEDDTEEAKTLIVEPHVIPNRGPYPYNQPKR RNTIQFTHTQIEAIRAGMQPGLT

M VVGPPGTGKTDVAVQIISNIYHNFPEQRTLIVTHSNQ ALNQLFEKIMALDIDERHLLRLGHGEEELETEKDFSR RYGRVNYVLARRIELLEEVKRL

QKSLGVPGDASYTCETAGYFFLYQ - UNI2876 - VMSRWEEYMSRVKNSGTACPDAAPDAAQVATFFPFHEYFANAPQPIFKGRSYEEDMEIAEGCF

RHIKKIFTQLE EFRASELLRSGLDRSKYLLVKEAKIIAMTCTHAALKRHDLVKLGFK YDNILMEEAAQILEIETFIPLLLQ NPQDGFSRLKRWIMIG

DHHQLPPVIKNMAFQKYSNMEQSLFTRFVRVGVPTVDLDAQGRARAS SLCNLYNWRYKNLGNLPHVQLLPEFSTANAGLLYDFQLINVEDFQGVGESEP

NPYFYQ - UNI1884 - NLGEAEYVVALFMYMCLLGYPADKISILTTYNGQKHLIRDIINRRCGNNPLIGRPNK VTTVDRFQGQQNDYILLSLVRTR

AVGHLR RDVRRLVVAMSRARLGLYIFARVSLFQNCFELTPAFSQLTARPLHLHIIPTEPFPTSRK NGERPPHEVQVIKNMPQMANFVYNMYMHLIQTT

HHYHQ - UNI26158 - TFLQLPPAMVEEGEEGQSQETEMEAEEETVSAQGNLTPSPADASLSQETPAAQPDCSSQTEDTSAPCDIATAAEPVSAAAE

AATPQDAESVPTETE
Transcript ENSMUST00000102543
Sequence
CCGGGACTTCTCAGGTTCCGGGAGGAACCGTGGGAGCCCAGCGTGTCTGTGCCGGGCGCTCTGGCACCTCGGGGCTGGGTCGCCGCCGCTGCTTGAAAGC

TTTCGAGAGTCGCCGCTACGAGCCTCTGGTCAGCTTCAGTGGCGATCGCTGCGATGGCGGCTCCTGCGCAGCCCAAGAAAATCGTGGCCCCCACGGTGTC

CCAGATCAACGCGGAGTTCGTCACTCAG - UNI17459 - CTAGCATGTAAATACTGGGCTCCTCATATCAAGAAGAAATCACCGTTTGATATAAAA 

GTAATTGAAGAAATATATGAAAAAGAGATCGTCAAATCACG GTTTGCCATCAGGAAAATAATGCTGCTGGAATTTAG - UNI27226 - CCAATACC

TTGAAAATTATCTTTGGATGAATTATTCTCCGGAAGTTTCCAGCAAGGCCTATTTAATGTCCATCTGCTGTATGGTGAATGAGAAGTTCAGAGAAAATGT

CCCAGCCTGGGAG ACCTTTAAGAAGAAACCAGACCACTTCCCATTCTTTTTTAAGTGCATCTTGAAAGCGGCCTTAGCTGAGACTGACGGCGAGTTCTC

CCTCCACGAGCAGACACTGCTCCTGCTTTTCCTGGATCACTGCTTCAATAGCTTG GAAGTAGACTTGATAAGGAGTCAGGTGCAGCAGCTTATCTCGCT

CCCGATGTGGATGGGCTTGCAGCCT GCACGATTGGAATTAGAATTGAAAAAGACACCAAAGCTAAGAAAATTCTGGAACCTGATTAAAAAGAATGATGA

AAAGATGGACCCAGAAGCAAGAGAGCA GGCCTACCAAGAAAGAAGGTTTCTCTCCCGGCTCATCCAGAAGTTCATCTCCGTGTTGAAGTCCATCCCGCT

TTCTG AGCCTGTCACCATGGACAAGGTTCATTACTGTGAAAGATTCATCGAACTGATGATTGATCTAGAG GCTCTACTCCCCACGAGGCGCTGGTTTA

ACACCATCCTGGATGACTCCCACCTTCTGGTTCACTGCTACCTCTCCAGTCTTGTTCACAGAGAAGAGGACGGCCATCTGTTTTCCCAG CTTTTAGACA

TGCTGAAGTTCTATACTGGCTTTGAGATTAACGACCAGACTGGAAATGCTCTGACAGAGAACGAGATGACCACGATTCACTATGACAGAATTACATCTCT

GCAG AGGGCTGCCTTCGCACACTTCCCCGAGCTCTATGACTTTGCCCTCTCCAATGTGGCAGAAGTAGATGCCCGAGATTCCTTGGTCAAGTTTTTTGG

GCCTCTCAG TTCAAACACACTCCACCAGGTGGCATCATACCTCTGCCTCTTGCCAACGCTCCCTAAAAATGAAGACACAACTTTTGATAAAGAGTTTCT

TCTAGAATTGCTG - UNI1094 - GTGTCTCGCCACGAACGCCGCATCTCTCAAATTCAGCAACTGAATCAGATGCCTTTGTATCCAACTGAGAAAAT

TATATGGGATGAGAACATCGTCCCTACTGAGTACTATTCTGGGGAAG GCTGCCTTGCTCTCCCCAAGTTGAATCTGCAGTTTTTGACTCTGCACGACTA

TCTCCTGAGGAACTTCAATCTCTTCCGCTTAGAGTCAACTTACGAAATTAGACAAGACATCGAGGACAGTGTCAGCAGAATGAAGCCCTG GCAGTCTGA

GTATGGTGGCGTAGTGTTCGGTGGTTGGGCACGGATGGCCCAGCCCATTGTGGCTTTCACTGTAGTCGAGGTTGCCAAACCCAACATCGGTGAAAACTGG

CCAACCCGAGTTCGTGCAGATGTCACCATCAATCTGAATGTCAGAGACCACATCAAGGATGAGTGGGAAG - UNI120 - GTCTTCGAAAGCACGATG

TATGCTTTTTAATTACTGTGCGTCCAACAAAACCTTACGGCACTAAGTTTGACAGGAGGAGACCTTTTATTGAGCAAGTTGGTCTGGTGTACGTCAGAGG

CTGTGAAATCCAGGGCATGCTGGATGACAAAGGGCGAGTCATCGAAGACG GACCTGAACCCAGACCCAATCTTAGAGGAGAGTCAAGGACATTTCGAGT

ATTTTTGGATCCAAACCAGTATCAACAGGATATGACCAATACGATACAAAACGGAGCCGAAGATGTGTATGACACTTTCAATGTCATAATGAGGAGGAAA

CCGAAGGAGAATAACTTCAAG GCTGTGTTGGAGACGATTCGGAATCTGATGAATACTGACTGCGTGGTACCGGACTGGCTGCATGACATCATTTTGGGC

TATGGGGACCCAAGTAGTGCCCATTATTCAAAAATGCCCAATCAGATTGCCACCCTGGATTTCAATGACACTTTTCTCTCCATTGAACATTTAAAGGCCA

GCTTTCCTGGTCATAATGTCAAAGTGACTGTGAGTGACCCAGCACTCCAAATCCCCCCTTTCAG AATAACGTTCCCAGTAAGAAGTGGAAAGGGGAAGA

AAAGAAAAGATGCAGACGGGGAAGAAGATGACACAGAAGAAGCAAAGACCTTAATTGTGGAGCCTCATGTTATTCCTAATAGAGGCCCTTATCCTTACAA

CCAGCCCAAACG TAATACAATCCAGTTCACTCATACACAGATAGAGGCCATCCGGGCCGGAATGCAGCCTGGACTCACCATG GTTGTGGGCCCACCTG

GTACAGGAAAAACAGATGTTGCAGTCCAGATCATATCCAACATTTACCACAATTTCCCAGAACAGAGGACTTTAATTGTTACTCATTCCAATCAG GCTC

TGAACCAGCTGTTTGAGAAAATCATGGCTTTAGACATTGATGAGCGCCATCTCCTGCGTCTGGGTCATGGAGAAGAAGAGCTAGAGACAGAGAAAGACTT

TAGCAG GTATGGAAGAGTTAATTATGTCCTAGCTCGAAGAATAGAACTTTTAGAAGAAGTCAAACGGTTACAAAAGAGTCTGGGGGTTCCCGGAGATGC

TTCGTATACCTGTGAAACTGCCGGCTATTTCTTCTTATATCAG - UNI2876 - GTGATGTCCCGCTGGGAAGAATACATGAGCAGAGTGAAGAACTC

GGGGACTGCCTGCCCGGACGCTGCCCCGGACGCTGCACAGGTCGCCACGTTCTTCCCCTTCCATGAGTATTTTGCCAATGCTCCTCAGCCCATCTTTAAA

GGCAGATCTTATGAGGAAGACATGGAAATCGCTGAAGGGTGCTTCAGGCACATTAAGAAAATCTTCACCCAACTTGAG GAGTTCAGAGCCTCGGAGCTG

CTTCGCAGTGGACTGGACAGATCCAAATACCTCTTGGTAAAAGAAGCCAAAATCATCGCTATGACATGTACTCATGCTGCCTTGAAACGACACGACTTGG

TCAAGTTGGGTTTCAAG TATGACAACATTTTAATGGAAGAGGCTGCTCAGATTCTGGAGATCGAAACCTTTATCCCTCTACTTCTGCAG AATCCTCAA

GACGGATTCAGCCGATTGAAACGGTGGATTATGATTGGCGATCACCACCAATTGCCTCCAGTCATTAAGAACATGGCCTTTCAGAAGTATTCCAACATGG

AGCAGTCTCTTTTCACTCGCTTCGTCCGGGTTGGAGTTCCTACTGTGGACCTTGATGCTCAAGGGAGAGCCAGGGCAAG CTTGTGTAACCTCTACAACT

GGCGCTACAAAAACCTAGGGAATTTGCCCCATGTGCAGCTCCTGCCAGAGTTCAGCACAGCCAACGCGGGCCTGCTGTATGACTTCCAGCTCATCAACGT

GGAAGACTTTCAGGGCGTGGGAGAGTCGGAGCCTAACCCTTACTTCTACCAG - UNI1884 - AACCTTGGAGAGGCAGAGTATGTAGTGGCGCTCTT

CATGTACATGTGCTTGCTTGGTTACCCTGCAGACAAGATCAGTATTCTAACAACCTACAATGGACAGAAGCATCTGATTCGGGACATCATCAATAGGCGC

TGTGGGAATAATCCACTGATTGGAAGGCCAAACAAA GTGACAACAGTTGACAGATTCCAGGGTCAGCAGAACGATTATATCCTCCTTTCGCTAGTGCGG

ACCAGGGCTGTGGGTCATCTGAG GGATGTGCGTCGCTTGGTGGTAGCCATGTCAAGAGCCAGGCTTGGCCTTTACATCTTCGCTCGAGTGTCCCTCTTC

CAGAACTGCTTTGAACTGACTCCTGCTTTCAGCCAGCTCACTGCCCGCCCACTGCATTTGCATATCATTCCAACAGAACCCTTCCCAACCTCCAGAAAG 

GCTCTTCCTTCTCCGGCACTTCTCTTGCCAGAGCTGCAGACACTGGATCATGCTCGGAGTGTGGCTGTTTTCTTCCAGCTGCAGAGTTCACTGTTCTGCT

CTTTTCACTGGATGAAATGTCCCAGAGATCTAGGAAATTTCAATAAACAGACAGTTTTATAA
Translation
MAAPAQPKKIVAPTVSQINAEFVTQ - UNI17459 - LACKYWAPHIKKKSPFDIK VIEEIYEKEIVKSR RFAIRKIMLLEFS - UNI27226 -

 SQYLENYLWMNYSPEVSSKAYLMSICCMVNEKFRENVPAWE TFKKKPDHFPFFFKCILKAALAETDGEFSLHEQTLLLLFLDHCFNSL EVDLIRSQV

QQLISLPMWMGLQP ARLELELKKTPKLRKFWNLIKKNDEKMDPEAREQ QAYQERRFLSRLIQKFISVLKSIPLSE EPVTMDKVHYCERFIELMIDLE

 ALLPTRRWFNTILDDSHLLVHCYLSSLVHREEDGHLFSQ LLDMLKFYTGFEINDQTGNALTENEMTTIHYDRITSLQ RAAFAHFPELYDFALSNVAE

VDARDSLVKFFGPLS SSNTLHQVASYLCLLPTLPKNEDTTFDKEFLLELL - UNI1094 - VSRHERRISQIQQLNQMPLYPTEKIIWDENIVPTEY

YSGEG GCLALPKLNLQFLTLHDYLLRNFNLFRLESTYEIRQDIEDSVSRMKPW WQSEYGGVVFGGWARMAQPIVAFTVVEVAKPNIGENWPTRVRADV

TINLNVRDHIKDEWEG - UNI120 - GLRKHDVCFLITVRPTKPYGTKFDRRRPFIEQVGLVYVRGCEIQGMLDDKGRVIEDG GPEPRPNLRGESRT

FRVFLDPNQYQQDMTNTIQNGAEDVYDTFNVIMRRKPKENNFK AVLETIRNLMNTDCVVPDWLHDIILGYGDPSSAHYSKMPNQIATLDFNDTFLSIEH

LKASFPGHNVKVTVSDPALQIPPFR RITFPVRSGKGKKRKDADGEEDDTEEAKTLIVEPHVIPNRGPYPYNQPKR RNTIQFTHTQIEAIRAGMQPGLT

M VVGPPGTGKTDVAVQIISNIYHNFPEQRTLIVTHSNQ ALNQLFEKIMALDIDERHLLRLGHGEEELETEKDFSR RYGRVNYVLARRIELLEEVKRL

QKSLGVPGDASYTCETAGYFFLYQ - UNI2876 - VMSRWEEYMSRVKNSGTACPDAAPDAAQVATFFPFHEYFANAPQPIFKGRSYEEDMEIAEGCF

RHIKKIFTQLE EFRASELLRSGLDRSKYLLVKEAKIIAMTCTHAALKRHDLVKLGFK YDNILMEEAAQILEIETFIPLLLQ NPQDGFSRLKRWIMIG

DHHQLPPVIKNMAFQKYSNMEQSLFTRFVRVGVPTVDLDAQGRARAS SLCNLYNWRYKNLGNLPHVQLLPEFSTANAGLLYDFQLINVEDFQGVGESEP

NPYFYQ - UNI1884 - NLGEAEYVVALFMYMCLLGYPADKISILTTYNGQKHLIRDIINRRCGNNPLIGRPNK VTTVDRFQGQQNDYILLSLVRTR

AVGHLR RDVRRLVVAMSRARLGLYIFARVSLFQNCFELTPAFSQLTARPLHLHIIPTEPFPTSRK ALPSPALLLPELQTLDHARSVAVFFQLQSSLFC

SFHWMKCPRDLGNFNKQTVL

For any suggestions or comments, please send an email to unitrap@crg.es