Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040385 (Ppp1ca)
Chromosomal location
Chr 19: 4192178 - 4195419 (+)
Description
protein phosphatase 1, catalytic subunit, alpha isoform Gene [Source:MGI Symbol;Acc:MGI:103016]
RefSeq_dna
NM_031868 
RefSeq_peptide
NP_114074.1 
MGI
MGI:103016 
Uniprot/SWISSPROT
P62137 
Uniprot/SPTREMBL
Q3U8W0 Q3TYF5 
Human Ortholog
ENSG00000172531 (PPP1CA)
Omim not available
UniTrap UNI24007
Vector Insertion
Chr 19: 4192486 - 4192744
Public Clones not available
Private Clones OST237946 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13275
Vector Insertion
Chr 19: 4192877 - 4193021
Public Clones (sanger) E067A05 (ggtc) E126E01 (ggtc) CMHD-GT_364D5-3 (cmhd) CMHD-GT_340G11-3 (cmhd)
Private Clones OST347367 (lexicon) OST253267 (lexicon) OST225381 (lexicon) OST50094 (lexicon)
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1322
Vector Insertion
Chr 19: 4193253 - 4193766
Public Clones DC0085 (sanger) E067A05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 43% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17274
Vector Insertion
Chr 19: 4193872 - 4194466
Public Clones not available
Private Clones OST446103 (lexicon)
Severity of mutation (?) Insertion after 53% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25827
Vector Insertion
Chr 19: 4194907 - 4194981
Public Clones not available
Private Clones OST160490 (lexicon)
Severity of mutation (?) Insertion after 89% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000046094
Sequence
GAGGGCCCGGAGCTGGTGGGCCGGAGCGGCGGCGCCGCCATGTCCGACAGCGAGAAGCTCAACCTGGACTCCATCATCGGGCGCCTGCTGGAAG - UNI

24007 - TGCAGGGCTCACGGCCTGGGAAGAACGTGCAGCTGACAGAGAACGAGATCCGTGGTCTGTGCCTCAAATCCCGGGAGATTTTCCTGAGCCAG

CCCATTCTTCTGGAGCTTGAGGCGCCCCTCAAGATCTGTG - UNI13275 - GTGACATCCATGGCCAGTACTATGACCTTCTACGGCTGTTTGAGTA

TGGTGGCTTCCCTCCAGAGAGCAACTACCTCTTCTTGGGGGATTATGTAGATCGGGGCAAGCAGTCTTTGGAGACCATCTGCCTGTTGCTGGCCTATAAG

ATCAGATACCCGGAGAATTTCTTTCTACTTCGTGGGAACCATGAGTGTGCCAGCATCAACCGCATTTATGGCTTCTATGATGAAT - UNI1322 - GC

AAGAGAAGATACAACATCAAACTGTGGAAGACGTTCACTGACTGCTTCAACTGCCTGCCCATTGCAGCCATTGTGGATGAGAAGATCTTCTGCTGCCACG

GGG - UNI17274 - GCCTGTCTCCAGACTTGCAATCCATGGAGCAGATTAGGCGTATTATGCGGCCCACAGACGTGCCTGACCAGGGCCTACTGTGT

GATCTCCTGTGGTCTGACCCTGACAAGGATGTTCAAGGCTGGGGCGAGAATGACCGTGGTGTCTCCTTTACCTTTGGGGCTGAGGTGGTAGCCAAGTTCC

TGCACAAGCATGATTTGGACCTCATCTGCAGAGCACATCAG GTTGTAGAAGATGGCTATGAGTTCTTTGCCAAGAGACAGTTGGTGACACTCTTCTCAG

CTCCCAACTACTGTGGAGAGTTTGACAATGCTGGTGCCATGATGAGTGTGGATGAGACCCTCATGTGTTCCTTCCAG - UNI25827 - ATCCTCAAG

CCCGCTGATAAGAATAAGGGCAAGTATGGGCAGTTCAGCGGCCTGAACCCCGGAGGCCGGCCCATCACTCCACCCCGCAATTCTGCCAAAGCCAAGAAAT

AGCCTCCATGTGCTGCCCTTCTGCCCCAGATCGTTTGTACAGAAATCATGCTGCCATGGGTCACACTGGCCTCTCAGGCCCACCCGTCACGGGGAACACA

CAGCGTTAAGTGTCTTTCCTTTATTTTTTAAAGAATCAATAGCAGCATCTAATCTCCCAGGGCTCCCTCCCACCAGCACCTGTGGTGGCTGCAAGTGGAA

TCCTGGGGCCAAGGCTGCAGCTCAGGGCAATGGCAGACCAGATTGTGGGTCTCCAGCCTTGCATGGCTGGCAGCCAGATCCTGGGGCAACCCATCTGGTC

TCTTGAATAAAGGTCAAAGCTGGATTCTC
Translation
MSDSEKLNLDSIIGRLLEV - UNI24007 - VQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICG - UNI13275 - GDIHGQYY

DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIRYPENFFLLRGNHECASINRIYGFYDEC - UNI1322 - CKRRYNIKLWKTFTDCF

NCLPIAAIVDEKIFCCHGG - UNI17274 - GLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDL

DLICRAHQ VVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQ - UNI25827 - ILKPADKNKGKYGQFSGLNPGGRPITPPRNSA

KAKK
Transcript ENSMUST00000113866
Sequence
GGCTTTGGAGCGCGCTCAGAGGCCGGGGGTGCACGAGTGCCCGGGACTCAGG - UNI24007 - TGCAGGGCTCACGGCCTGGGAAGAACGTGCAGCT

GACAGAGAACGAGATCCGTGGTCTGTGCCTCAAATCCCGGGAGATTTTCCTGAGCCAGCCCATTCTTCTGGAGCTTGAGGCGCCCCTCAAGATCTGTG -

 UNI13275 - GTGACATCCATGGCCAGTACTATGACCTTCTACGGCTGTTTGAGTATGGTGGCTTCCCTCCAGAGAGCAACTACCTCTTCTTGGGGGA

TTATGTAGATCGGGGCAAGCAGTCTTTGGAGACCATCTGCCTGTTGCTGGCCTATAAGATCAGATACCCGGAGAATTTCTTTCTACTTCGTGGGAACCAT

GAGTGTGCCAGCATCAACCGCATTTATGGCTTCTATGATGAAT - UNI1322 - GCAAGAGAAGATACAACATCAAACTGTGGAAGACGTTCACTGAC

TGCTTCAACTGCCTGCCCATTGCAGCCATTGTGGATGAGAAGATCTTCTGCTGCCACGGGG - UNI17274 - GCCTGTCTCCAGACTTGCAATCCAT

GGAGCAGATTAGGCGTATTATGCGGCCCACAGACGTGCCTGACCAGGGCCTACTGTGTGATCTCCTGTGGTCTGACCCTGACAAGGATGTTCAAGGCTGG

GGCGAGAATGACCGTGGTGTCTCCTTTACCTTTGGGGCTGAGGTGGTAGCCAAGTTCCTGCACAAGCATGATTTGGACCTCATCTGCAGAGCACATCAG 

GTTGTAGAAGATGGCTATGAGTTCTTTGCCAAGAGACAGTTGGTGACACTCTTCTCAGCTCCCAACTACTGTGGAGAGTTTGACAATGCTGGTGCCATGA

TGAGTGTGGATGAGACCCTCATGTGTTCCTTCCAG - UNI25827 - ATCCTCAAGCCCGCTGATAAGAATAAGGGCAAGTATGGGCAGTTCAGCGGC

CTGAACCCCGGAGGCCGGCCCATCACTCCACCCCGCAATTCTGCCAAAGCCAAGAAATAGCCTCCATGTGCTGCCCTTCTGCCCCAGATCGTTTGTACAG

AAATCATGCTGCCATGGGTCACACTGGCCTCTCAGGCCCACCCGTCACGGGGAACACACAGCGTTAAGTGTCTTTCCTTTATTTTTTAAAGAATCAATAG

CAGCATCTAATCTCCCAGGGCTCCCTCCCACCAGCACCTGTGGTGGCTGCAAGTGGAATCCTGGGGCCAAGGCTGCAGCTCAGGGCAATGGCAGACCAGA

TTGTGGGTCTCCAGCCTTGCATGGCTGGCAGCCAGATCCTGGGGCAACCCATCTGGTCTCTTGAATAAAGGTCAAAGCTGGATTCTC
Translation
GFGARSEAGGARVPGTQV - UNI24007 - VQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICG - UNI13275 - GDIHGQYYD

LLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIRYPENFFLLRGNHECASINRIYGFYDEC - UNI1322 - CKRRYNIKLWKTFTDCFN

CLPIAAIVDEKIFCCHGG - UNI17274 - GLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLD

LICRAHQ VVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQ - UNI25827 - ILKPADKNKGKYGQFSGLNPGGRPITPPRNSAK

AKK

For any suggestions or comments, please send an email to unitrap@crg.es