Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040390 (Map3k10)
Chromosomal location
Chr 7: 28441396 - 28459617 (-)
Description
mitogen-activated protein kinase kinase kinase 10 Gene [Source:MGI (curated);Acc:Map3k10-001]
RefSeq_dna
NM_001081292 
RefSeq_peptide
NP_001074761.1 
UniGene
Mm.389883 Mm.397219 
MGI
MGI:1346879 
Uniprot/SWISSPROT
Q66L42 
Human Ortholog
ENSG00000130758 (MAP3K10)
Omim not available
UniTrap UNI27893
Vector Insertion
Chr 7: 28444194 - 28446553
Public Clones not available
Private Clones OST45104 (lexicon)
Severity of mutation (?) Insertion after 55% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108341
Sequence
AAGAGCCCCGGCGGGGAGAGGGACTTAGGGGGCCGACCAGGAGCCGGCTGAGGAGGATGGGGGCCGCCCACGCGTTCCTCGCGTGAGGAGGCCGAGGGGC

GCGCCACCCCATCCCGGGGCGGCCGCCCCCGGGGCGCCGCCATCCCTGCCCGGCCCTGCGGTCGTGGCTGAGGATGCGGAGCCGGGGGCCGCCGGTGGAG

CTGCGCGGGGTGAGAGGCGCGGGGAGGGGCGGCCGCTTGCTGCCCTCGGCCTCGGCCTCCGCCGGCGGGCCCCGCTCGACCCGGCCCTCCCTGCGCCCTG

ACATCGTTGGGGACAGGTGAACCTAACGCCTCTCCTGCACAGCCAAATCCGAGGGATCGGTCCTATCGTTTGAAAAAGGTGTTTTTTAGGTTTTTGGGGT

TTTTTTTCTTTTTAATTCCTTCGCTCCAGCGGAGGCCCCTCCCCCAGCTATGGTCCCCAGGAGCCCCCCGGGGTCCGCAGGGACTGTCTCCCATCCCGGC

CTCCCGGCCCCGCGCTCAGCATTCCGCGGGCAGCCTGCGTGAAGCGGCCTCCCGCAGCCCCCGGCCCCTCCCCCATGGAGGAGGAGGAGGGGGCGGCGGC

CAGAGAGTGGGGCGCGACCCCCGCGGGGCCAGTGTGGACCGCCGTGTTCGACTACGAGGCGGTGGGCGACGAGGAGCTGACCCTGCGGAGAGGCGACCGC

GTCCAGGTGCTTTCCCAGGACTGTGCGGTGTCTGGAGATGAGGGCTGGTGGACAGGGCAGCTGCCCAGCGGCCGTGTGGGCGTCTTCCCCAGCAACTACG

TGGCCCCCGCTGCACCCGCCGCACCCTCAGACCTCCAGCTGCCACAGGAGATCCCCTTCCACGAGCTGCAGCTGGAGGAGATCATCGGTGTCGGGGGCTT

TGGCAAAGTCTATCGCGCCGTATGGCGTGGAGAGGAAGTAGCGGTCAAGGCCGCTCGGCTGGACCCTGAACGGGACCCGGCAGTGACAGCGGAGCAGGTC

CGCCAGGAGGCCCGGCTCTTTGGAGCCCTGCAGCACCCCAACATCATTGCCCTGAGGGGCGCCTGCCTCAGCCCCCCAAACCTCTGCCTGGTGATGGAAT

ATGCTCGGGGAGGTGCATTGAGCAGGGTACTGGCAGGTCGCCGGGTCCCCCCTCATGTGCTGGTCAACTGGGCTGTGCAGGTGGCTCGGGGCATGAACTA

TCTACACAATGATGCCCCTGTGCCCATCATTCACCGGGACCTCAAGTCCATCAACA TCCTAATCCTGGAGGCCATTGAGAACCACAACCTCGCTGACAC

GGTGCTCAAGATCACAGACTTCGGCCTTGCCCGAGAGTGGCACAAGACGACCAAAATGAGTGCAGCGGGGACCTACGCCTGGATGGCTCCTGAGGTTATC

CGCCTGTCCCTCTTCTCCAAAAGCAGCGACGTCTGGAG CTTCGGGGTTCTTCTTTGGGAGCTGCTGACCGGGGAGGTCCCCTACCGAGAAATCGACGCC

TTGGCCGTGGCTTACGGTGTGGCTATGAACAAGCTGACGCTACCCATCCCCTCCACGTGCCCCGAGCCCTTTGCCCGCCTACTGGAGG AATGCTGGGAC

CCAGACCCTCACGGGCGACCAGATTTTGGCAGCATCCTGAAGCAGCTGGAGGTCATCGAGCAGTCAGCCCTGTTCCAGATGCCACTGGAGTCCTTCCACT

CCCTGCAGGAAGACTGGAAGCTGGAGATTCAGCATATGTTTGATGACCTTCGGACCAAGGAGAAG GAGTTGCGCAGCCGGGAAGAGGAGCTATTGCGGG

CTGCACAGGAGCAGCGTTTTCAGGAAGAGCAGCTACGGCGTCGGGAGCAGGAGCTGGCAGAGCGAGAGATGGACATCGTAGAACGTGAGCTGCACCTGCT

CATGAGCCAGCTGAGCCAGGAGAAGCCCAGGGTCCGAAAACGCAAGGGCAACTTCAAGCGCAGCCGCTTGCTCAAGCTACGGGAAGGAAGCAGCCACATC

AGCCTGCCCTCTG GATTTGAACATAAGATCACCGTCCAGGCCTCCCCAACCCTGGACAAGAGGAAAGGATCCGATGGGGCCAGCCCTCCTGCCAGCCCC

AGCATCATTCCCCGGTTGAGGGCCATTCGAT - UNI27893 - TGACTCCCATGGACTGTGGTGGCAGCAGTGGTAGTGGAACATGGAGCCGCAGTGG

GCCACCAAAGAAGGAAGAACTGGTTGGGGGCAAGAAGAAAGGCAGGACATGGGGCCCCAGTTCCACTTTGCAGAAGGAGCGAGCTGGAGGAGAGGAGAG 

GCTCAAGGCCCTGGGGGAAGGAAGCAAGCAGTGGTCCTCGAGCGCCCCCAACCTGGGCAAATCCCCTAAGCACACCCCCATGGCCCCAGGCTTCGCCAGC

CTCAACGAGATGG AAGAATTTGCGGAGGCAGATGAAGGCAACAACGTGCCCCCTTCTCCCTACTCCACCCCGTCCTACCTCAAGGTGCCTCTGCCCGCC

GAGCCTTCTCCTTGTGTTCAGGCGCCTTGGGAGCCGCCGGCTGTCACCCCTTCCCGGCCAGGACACGGAGCTCGTAGGCGCTGCGACCTGGCGCTGCTAA

GCTGTGCCACGCTGCTGAGTGCGGTGGGCCTGGGCGCCGACGTGGCCGAGGCACGGGCCGGGGACGGTGAGGAGCAGCGGCGCTGGCTGGACAGTCTCTT

CTTCCCGCGCCCCGGCCGCTTCCCTCGCGGTCTCAGCCCAACCGGGCGCCCCGGAGGTCGCCGCGAAGACACAGCCCCAGGCTTGGGTCTGGCACCCTCG

GCCACCCTGGTGTCATTATCCTCTGTATCGGATTGTAACTCTACGCGCTCATTGCTGCGCTCTGACAGTGACGAGGCTGCCCCTGCCGCCCCCTCCCCGC

CGCCTTCTCCGCTCGCGCCCTCACCCAGCACCAATCCTCTCGTGGACGTGGAGTTGGAGAGCTTCAAGAAGGACCCCCGGCAGTCACTTACGCCCACCCA

CGTCACTGCCGCCCACGCTGTGAGCCGTGGACACAGGCGGACGCCATCAGATGGGGCTTTGAGACAACGGGAGCCTCTGGAGCTCACCAACCACG GACA

GG GTCCTCGAGACCCCCTGGACTTCCCTCGACTGCCCGACCCCCAGGCCCTGTTCCCTACCCGACGCCGGCCCCTGGAGTTCCCTGGCCGCCCCACCAC

CCTCACTTTTGCCCCAAGACCCCGGCCTGCTGCCAGCCGCCCCCGTCTGGATCCCTGGAAACTGGTCTCCTTTGGCCGGACACTCAGCATCTCGCCTCCA

AGCAGGCCAGACACTCCAGAGAGCCCTGGGCCCCCCAGCGTGCAACCCACGTTGCTGGACATGGACATGGAGGGCCAGAGCCAGGACAATACAGTGCCCC

TATGTGGGGTCTATGGCTCTCACTGA
Translation
MEEEEGAAAREWGATPAGPVWTAVFDYEAVGDEELTLRRGDRVQVLSQDCAVSGDEGWWTGQLPSGRVGVFPSNYVAPAAPAAPSDLQLPQEIPFHELQL

EEIIGVGGFGKVYRAVWRGEEVAVKAARLDPERDPAVTAEQVRQEARLFGALQHPNIIALRGACLSPPNLCLVMEYARGGALSRVLAGRRVPPHVLVNWA

VQVARGMNYLHNDAPVPIIHRDLKSINI ILILEAIENHNLADTVLKITDFGLAREWHKTTKMSAAGTYAWMAPEVIRLSLFSKSSDVWS SFGVLLWEL

LTGEVPYREIDALAVAYGVAMNKLTLPIPSTCPEPFARLLEE ECWDPDPHGRPDFGSILKQLEVIEQSALFQMPLESFHSLQEDWKLEIQHMFDDLRTK

EK ELRSREEELLRAAQEQRFQEEQLRRREQELAEREMDIVERELHLLMSQLSQEKPRVRKRKGNFKRSRLLKLREGSSHISLPSG GFEHKITVQASPT

LDKRKGSDGASPPASPSIIPRLRAIRL - UNI27893 - LTPMDCGGSSGSGTWSRSGPPKKEELVGGKKKGRTWGPSSTLQKERAGGEER RLKALG

EGSKQWSSSAPNLGKSPKHTPMAPGFASLNEME EEFAEADEGNNVPPSPYSTPSYLKVPLPAEPSPCVQAPWEPPAVTPSRPGHGARRRCDLALLSCAT

LLSAVGLGADVAEARAGDGEEQRRWLDSLFFPRPGRFPRGLSPTGRPGGRREDTAPGLGLAPSATLVSLSSVSDCNSTRSLLRSDSDEAAPAAPSPPPSP

LAPSPSTNPLVDVELESFKKDPRQSLTPTHVTAAHAVSRGHRRTPSDGALRQREPLELTNHG GQG GPRDPLDFPRLPDPQALFPTRRRPLEFPGRPTT

LTFAPRPRPAASRPRLDPWKLVSFGRTLSISPPSRPDTPESPGPPSVQPTLLDMDMEGQSQDNTVPLCGVYGSH
Transcript ENSMUST00000036453
Sequence
ATGGAGGAGGAGGAGGGGGCGGCGGCCAGAGAGTGGGGCGCGACCCCCGCGGGGCCAGTGTGGACCGCCGTGTTCGACTACGAGGCGGTGGGCGACGAGG

AGCTGACCCTGCGGAGAGGCGACCGCGTCCAGGTGCTTTCCCAGGACTGTGCGGTGTCTGGAGATGAGGGCTGGTGGACAGGGCAGCTGCCCAGCGGCCG

TGTGGGCGTCTTCCCCAGCAACTACGTGGCCCCCGCTGCACCCGCCGCACCCTCAGACCTCCAGCTGCCACAGGAGATCCCCTTCCACGAGCTGCAGCTG

GAGGAGATCATCGGTGTCGGGGGCTTTGGCAAAGTCTATCGCGCCGTATGGCGTGGAGAGGAAGTAGCGGTCAAGGCCGCTCGGCTGGACCCTGAACGGG

ACCCGGCAGTGACAGCGGAGCAGGTCCGCCAGGAGGCCCGGCTCTTTGGAGCCCTGCAGCACCCCAACATCATTGCCCTGAGGGGCGCCTGCCTCAGCCC

CCCAAACCTCTGCCTGGTGATGGAATATGCTCGGGGAGGTGCATTGAGCAGGGTACTGGCAGGTCGCCGGGTCCCCCCTCATGTGCTGGTCAACTGGGCT

GTGCAGGTGGCTCGGGGCATGAACTATCTACACAATGATGCCCCTGTGCCCATCATTCACCGGGACCTCAAGTCCATCAACA TCCTAATCCTGGAGGCC

ATTGAGAACCACAACCTCGCTGACACGGTGCTCAAGATCACAGACTTCGGCCTTGCCCGAGAGTGGCACAAGACGACCAAAATGAGTGCAGCGGGGACCT

ACGCCTGGATGGCTCCTGAGGTTATCCGCCTGTCCCTCTTCTCCAAAAGCAGCGACGTCTGGAG CTTCGGGGTTCTTCTTTGGGAGCTGCTGACCGGGG

AGGTCCCCTACCGAGAAATCGACGCCTTGGCCGTGGCTTACGGTGTGGCTATGAACAAGCTGACGCTACCCATCCCCTCCACGTGCCCCGAGCCCTTTGC

CCGCCTACTGGAGG AATGCTGGGACCCAGACCCTCACGGGCGACCAGATTTTGGCAGCATCCTGAAGCAGCTGGAGGTCATCGAGCAGTCAGCCCTGTT

CCAGATGCCACTGGAGTCCTTCCACTCCCTGCAGGAAGACTGGAAGCTGGAGATTCAGCATATGTTTGATGACCTTCGGACCAAGGAGAAG GAGTTGCG

CAGCCGGGAAGAGGAGCTATTGCGGGCTGCACAGGAGCAGCGTTTTCAGGAAGAGCAGCTACGGCGTCGGGAGCAGGAGCTGGCAGAGCGAGAGATGGAC

ATCGTAGAACGTGAGCTGCACCTGCTCATGAGCCAGCTGAGCCAGGAGAAGCCCAGGGTCCGAAAACGCAAGGGCAACTTCAAGCGCAGCCGCTTGCTCA

AGCTACGGGAAGGAAGCAGCCACATCAGCCTGCCCTCTG GATTTGAACATAAGATCACCGTCCAGGCCTCCCCAACCCTGGACAAGAGGAAAGGATCCG

ATGGGGCCAGCCCTCCTGCCAGCCCCAGCATCATTCCCCGGTTGAGGGCCATTCGAT - UNI27893 - TGACTCCCATGGACTGTGGTGGCAGCAGT

GGTAGTGGAACATGGAGCCGCAGTGGGCCACCAAAGAAGGAAGAACTGGTTGGGGGCAAGAAGAAAGGCAGGACATGGGGCCCCAGTTCCACTTTGCAGA

AGGAGCGAGCTGGAGGAGAGGAGAG GCTCAAGGCCCTGGGGGAAGGAAGCAAGCAGTGGTCCTCGAGCGCCCCCAACCTGGGCAAATCCCCTAAGCACA

CCCCCATGGCCCCAGGCTTCGCCAGCCTCAACGAGATGG AAGAATTTGCGGAGGCAGATGAAGGCAACAACGTGCCCCCTTCTCCCTACTCCACCCCGT

CCTACCTCAAGGTGCCTCTGCCCGCCGAGCCTTCTCCTTGTGTTCAGGCGCCTTGGGAGCCGCCGGCTGTCACCCCTTCCCGGCCAGGACACGGAGCTCG

TAGGCGCTGCGACCTGGCGCTGCTAAGCTGTGCCACGCTGCTGAGTGCGGTGGGCCTGGGCGCCGACGTGGCCGAGGCACGGGCCGGGGACGGTGAGGAG

CAGCGGCGCTGGCTGGACAGTCTCTTCTTCCCGCGCCCCGGCCGCTTCCCTCGCGGTCTCAGCCCAACCGGGCGCCCCGGAGGTCGCCGCGAAGACACAG

CCCCAGGCTTGGGTCTGGCACCCTCGGCCACCCTGGTGTCATTATCCTCTGTATCGGATTGTAACTCTACGCGCTCATTGCTGCGCTCTGACAGTGACGA

GGCTGCCCCTGCCGCCCCCTCCCCGCCGCCTTCTCCGCTCGCGCCCTCACCCAGCACCAATCCTCTCGTGGACGTGGAGTTGGAGAGCTTCAAGAAGGAC

CCCCGGCAGTCACTTACGCCCACCCACGTCACTGCCGCCCACGCTGTGAGCCGTGGACACAGGCGGACGCCATCAGATGGGGCTTTGAGACAACGGGAGC

CTCTGGAGCTCACCAACCACG GTCCTCGAGACCCCCTGGACTTCCCTCGACTGCCCGACCCCCAGGCCCTGTTCCCTACCCGACGCCGGCCCCTGGAGT

TCCCTGGCCGCCCCACCACCCTCACTTTTGCCCCAAGACCCCGGCCTGCTGCCAGCCGCCCCCGTCTGGATCCCTGGAAACTGGTCTCCTTTGGCCGGAC

ACTCAGCATCTCGCCTCCAAGCAGGCCAGACACTCCAGAGAGCCCTGGGCCCCCCAGCGTGCAACCCACGTTGCTGGACATGGACATGGAGGGCCAGAGC

CAGGACAATACAGTGCCCCTATGTGGGGTCTATGGCTCTCACTGAGACCTGCCCACCACCACCCGCCTGGGCAGCCATGAATGTAGCGCCCCAGGCCTGC

CACAGCCCACCATTTGCCAAGGTGGGGGAGGCCCTGGGCAGGATACTCACTCTATTTATTGGGGAAGGGGGGAGGGGAGGACACTTAATTTATTCCTTTG

TACCCCAGGTTGTGGAGCTCTGAGCCCAATCTGCTGTGGGGAGAGGGTGGGTGGGCAGGGATACTCAGGGACAGAATATTGTGGGGGATCTGGCACAAGG

CGCAGCATTAAAGGTAAGCCCTGCCCCCTACC
Translation
MEEEEGAAAREWGATPAGPVWTAVFDYEAVGDEELTLRRGDRVQVLSQDCAVSGDEGWWTGQLPSGRVGVFPSNYVAPAAPAAPSDLQLPQEIPFHELQL

EEIIGVGGFGKVYRAVWRGEEVAVKAARLDPERDPAVTAEQVRQEARLFGALQHPNIIALRGACLSPPNLCLVMEYARGGALSRVLAGRRVPPHVLVNWA

VQVARGMNYLHNDAPVPIIHRDLKSINI ILILEAIENHNLADTVLKITDFGLAREWHKTTKMSAAGTYAWMAPEVIRLSLFSKSSDVWS SFGVLLWEL

LTGEVPYREIDALAVAYGVAMNKLTLPIPSTCPEPFARLLEE ECWDPDPHGRPDFGSILKQLEVIEQSALFQMPLESFHSLQEDWKLEIQHMFDDLRTK

EK ELRSREEELLRAAQEQRFQEEQLRRREQELAEREMDIVERELHLLMSQLSQEKPRVRKRKGNFKRSRLLKLREGSSHISLPSG GFEHKITVQASPT

LDKRKGSDGASPPASPSIIPRLRAIRL - UNI27893 - LTPMDCGGSSGSGTWSRSGPPKKEELVGGKKKGRTWGPSSTLQKERAGGEER RLKALG

EGSKQWSSSAPNLGKSPKHTPMAPGFASLNEME EEFAEADEGNNVPPSPYSTPSYLKVPLPAEPSPCVQAPWEPPAVTPSRPGHGARRRCDLALLSCAT

LLSAVGLGADVAEARAGDGEEQRRWLDSLFFPRPGRFPRGLSPTGRPGGRREDTAPGLGLAPSATLVSLSSVSDCNSTRSLLRSDSDEAAPAAPSPPPSP

LAPSPSTNPLVDVELESFKKDPRQSLTPTHVTAAHAVSRGHRRTPSDGALRQREPLELTNHG GPRDPLDFPRLPDPQALFPTRRRPLEFPGRPTTLTFA

PRPRPAASRPRLDPWKLVSFGRTLSISPPSRPDTPESPGPPSVQPTLLDMDMEGQSQDNTVPLCGVYGSH

For any suggestions or comments, please send an email to unitrap@crg.es