Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040407 (Akap9)
Chromosomal location
Chr 5: 3928186 - 4080204 (+)
Description
A kinase (PRKA) anchor protein (yotiao) 9 Gene [Source:MGI (curated);Acc:Akap9-001]
RefSeq_dna
NM_194462 
RefSeq_peptide
NP_919444.2 
UniGene
Mm.415878 Mm.46044 
MGI
MGI:2178217 
Uniprot/SPTREMBL
Q3TH74 Q8BV41 Q8C0C6 Q9CS73 Q70FJ1 Q80TR6 Q99P24 Q9CVC1 
Human Ortholog
ENSG00000127914 (AKAP9)
Omim 611820 - LONG QT SYNDROME 11  
UniTrap UNI30740
Vector Insertion
Chr 5: 3928491 - 3948680
Public Clones (sanger) IST11066B11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35433
Vector Insertion
Chr 5: 3956313 - 3957623
Public Clones IST12256A8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 40% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2216
Vector Insertion
Chr 5: 3981117 - 3981215
Public Clones XP0050 (sanger) RRS166 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15225
Vector Insertion
Chr 5: 3981215 - 3992045
Public Clones (sanger) PST4786-NL (escells) IST11903C2 (tigm) IST12046H6 (tigm)
IST12442A3 (tigm) IST10500E2 (tigm) IST13821E5 (tigm) IST11877F12 (tigm)
IST12456E1 (tigm) IST10064F5 (tigm) IST13926H5 (tigm) IST12250H5 (tigm)
IST11563E4 (tigm) IST10892B10 (tigm) IST14995C2 (tigm) IST12087F9 (tigm)
IST14978B10 (tigm) IST14980G1 (tigm) IST12143D4 (tigm) IST12393E7 (tigm)
IST10720H7 (tigm) IST12291D12 (tigm) IST15025D9 (tigm) IST14668H5 (tigm)
IST10935D3 (tigm) IST11074G3 (tigm) IST12238A10 (tigm) IST14750D12 (tigm)
IST10140H12 (tigm) IST10009B7 (tigm) IST11153D1 (tigm) IST10212E1 (tigm)
IST11493B7 (tigm) IST13145G11 (tigm) IST10793F7 (tigm) IST12044E6 (tigm)
IST12399A3 (tigm) IST13689A11 (tigm) IST12037H8 (tigm) IST10595A5 (tigm)
IST10587D10 (tigm) IST13409B1 (tigm) IST10232B4 (tigm) IST12387D12 (tigm)
IST15102H4 (tigm) IST13601B6 (tigm) IST11354B12 (tigm) IST12178E3 (tigm)
IST10125D3 (tigm) IST11880D8 (tigm) IST14800G4 (tigm) IST13656G7 (tigm)
IST11751G3 (tigm) IST12440B10 (tigm) IST11254G8 (tigm) IST12103G4 (tigm)
IST12698H11 (tigm) IST10248B10 (tigm) IST10991D12 (tigm) IST12586B8 (tigm)
IST12697F12 (tigm) IST10801G11 (tigm) IST10573E7 (tigm) IST10559H6 (tigm)
IST11908A4 (tigm) IST10643F3 (tigm) IST12493C11 (tigm) IST13384C9 (tigm)
IST11618D12 (tigm) IST10319C8 (tigm) IST13561A9 (tigm) IST10567D4 (tigm)
IST14721E3 (tigm) IST12006F3 (tigm) IST13746F8 (tigm) IST14201F10 (tigm)
IST12673G7 (tigm) IST10865B7 (tigm) IST11512H9 (tigm) IST13110E12 (tigm)
IST12056B2 (tigm) IST12634G8 (tigm) IST11621B12 (tigm) IST13898A6 (tigm)
IST11517H9 (tigm) IST13845B2 (tigm) IST15032C10 (tigm) IST11806H7 (tigm)
IST12331A12 (tigm) IST13681D2 (tigm) IST10852H5 (tigm) IST10023E3 (tigm)
IST12434C11 (tigm) IST12394A1 (tigm) IST10557G12 (tigm) IST11809F11 (tigm)
IST11919H1 (tigm) IST14458F7 (tigm) IST11036D7 (tigm) IST10564C2 (tigm)
IST12356F7 (tigm) IST10704A1 (tigm) IST12649G1 (tigm) IST12250E7 (tigm)
IST11834A9 (tigm) IST10643A7 (tigm) IST12687B7 (tigm) IST12855C6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11029
Vector Insertion
Chr 5: 4028373 - 4028537
Public Clones W062A04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7611
Vector Insertion
Chr 5: 4034868 - 4038528
Public Clones RRR478 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32333
Vector Insertion
Chr 5: 4067923 - 4069006
Public Clones IST12071C1 (tigm) IST13206C4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000088917
Sequence
GGTCAAGCCGGGCGCGCACAAGCACCTGCCGGGCCACGCTCGCGGCTGCGCCGGCCGCCCGCCCGCCCGCTCCGCCCCGCCGGCCGCCGTGTGTTTACGT

GGAGACGAAGATGGCGGCGGTGACCGCGGGGCCCGTGCAGGCCGGCACGAGTCGCCGGTGAGCGCCCAGCGTGTCCCGGGTGGCCACGGAGCTCTGTCCG

CCTCTTTCTAAACAGATCTTTCCTCTCCACTGCGTCCCAGCCTACCCTGCAGACGCCATGGAGGACGAGGAGAGGCAAAGGAAGCTGGCAGCCGGCAAGG

CGAAG - UNI30740 - CTTGCTCGGTTTCGACAAAGAAAAGCCCAATATGATGGGGACATTCCGAAGAAACAGAAGAAGAAGAGGACGTCAAGCTCT

AAACATGATTCAAGCTTACATACTGATCAACAGAGTGGTGAGCTCTGCTCGGAAAGTTCTCAGAGGGTAGACTTAGCCGGGAATCCTGATTGCTCCGGGC

CAGAGAGAAAGCACGGCCAGGTCTTCTCTGCTGAA CCTGAAAGTGAAATTTCTACCACTGCAGATGAATGTAGCTCGGAG ATTAATGGCTGCAATTCT

GTGATGAAACCAAGAAAGCCTACAGATCCGTTAAGG GAAGAAGAATTTTCACTTGATGACTCCTCCTCTGAGCAAGGAGCTCAGTCCAGTCAGACCTGT

CTTCAGATGGTAGAAAAGGAGTTGGCCGAGAAGCAGCATGATATTGAAGAGTTGACTCAGGAGTTGGAAGAGATGAGGGCCAGCTTTGGGACCGAAGGGC

TGAAGCAG TTACAAGAATTTGAAGCCGCCATTAAACAGCGAGACGGCATCATAACTCAGCTCACAGCTAACTTGCAGCAAGCAAGGAGAGAGAAGGATG

ACACGATGGTAGAATTCTTAGAGCTGACAGAACAAAGTCAAAAACTGCAGATTCAGTTCCAGCAC - UNI35433 - TTACAGGCTAATGAAACTTTG

CAAAACAGCACTCTCAGCCGAACTGCGACAGATTTACTGCAGGCCAAACGACAGATCTTCACTCAACAGCAACAGCTGCAAGATTATCAGAAAAAGGAGG

AGGACCTCCAAGCGCAGATTTCTTTTTTACAAGAGAAATTAAGAGCGTTTGAAATG GAAAAAGACAGAAAAATAGAAAACTTAAATGCAAAAGAAATAC

AGGAGAAGCAGGCACTCATTGATGAGTTGAATACAAGAGTAGTAGAAGAAGAGAAGAAAACTGTTGAGTTAAAGAATAAAGTAACAACTGCTGATGAGTT

ACTAGGAGGGTTACACGAACAGCTTACACAGAGGAATCAGGAGATCCAAAGCCTGAAACTAGAACTGGGCAACTCTCAGCAGAACGAGCGGAAGTGTTCA

GAGGAAATCAAAGAGCTAATGAGGACAGTTGAAGAACTCCAGAAGAGAAACCTTAAAGATAGCTGGCTGGAAACTAGCGCCGTGCGAAGGGTGGAACAGG

AAACCCAACGGAAATTAAGCCATCTCCAAGCAGAGCTGGATGAGATGTATGGGAAGCAAATAGTGCAAATGAAACAAGAGTTAATAAATCAGCACATGTC

TCAGATAGAGGAGCTCAAATCCCAACATAAGAGAGAAATGGAGAACACCTTAAAGTCGGATACAAATGCTGCCATCAGTAAAGAACAAGTAAATTTAATG

AATGCCGCCATAAATGAACTCAATGTAAGATTACAGGAGACTCATGCTCAAAAGGAGGAACTCAAGGGAGAGCTTGGCGTAGTTCTGGGAGAAAAGTCAG

CTTTGCAAAGTCAGTCTAATGACCTCTTAGAAGAGGTAAGGTTTTTAAGAGAGCAAGTTCAGAAAGCTAGGCAGACAATCGCAGAGCAAGAGAACAGGCT

GAGTGAGGCGCGCAAGTCCCTGAGCACAGTGGAAGACCTAAAAGCTGAGATCGTGGCTGCCTCCGAATCCAGAAAGGAACTCGAGCTCAAGCATGAAGCC

GAGATTACAAATTATAAAATAAAACTTGAAATGCTAGAAAAAGAAAAAAATGCTGTGCTAGACAGAATGGCGGAATCCCAAGAAGCAGAGCTGGAGAGGC

TGAGAACACAGCTCCTCTTTAGTCATGAGGAAGAATTGTCTAAACTAAAAGAAGATTTAGAAGTAGAACATCGAATAAATATTGAAAAACTTAAAGATAA

TTTAGGCATTCACTACAAGCAACAGATAGACGGCTTACAGAATGAAATGAATAGGAAGATGGAAAGTATGCAGTGTGAAACAGACAACCTGATAACCCAG

CAGAATCAGTTAATTCTGGAAAATTCAAAGCTAAGAGATTTACAGGAATGCCTTGTTAACTCAAAATCAGAAGAAATGAATCTTCAAATCAATGAACTGC

AAAAAGAGATTGAAATCCTCAAACAAGAAGAAAAGGAGAAAGGTACCCTTGAGCAGGAAGTCCAGGAGTTGCAACTTAAAACTGAACAATTGGAGAAACA

GCTGAAGGAGAAGGAAGATGACCTTCAAGAAAAATGTGCACAGCTGGACGCAGAGAACAACATTCTCAAAGAGGAGAAGAGAGTCCTTGAAGACAAGTTG

AAAATGTACAGTCCTTCGGAACAAGAGGAGAGATCCATTGCCGTAGATCCCAGCACAAGCAAGTCGGCAGACTCGAGGTGGCAAAAAGAAGTAGCGATGC

TGAGGAAGGAGACCGAGGACCTTCAACAACAATGCCTTTATCTAAATGAAGAGATCGAGAAGCAAAGGAATACGTTTGCGTTTGCTGAAAAGAACTTTGA

AGTTAACTATCAAGAGTTACAGAGGGAGTATACTTGTCTGCTCAAGATAAGAGATGATTTAGAGGCCACACAGACCAAGCAGGCATTGGAATATGAGAGC

AAGCTGAGAGCGCTGGAGGAAGAGCTCCTTTCGAAAAGAGGAAATCCAGCCGCGCCAAAGGGGAAGAGTTCTGGAATTTTCCCATCTGAGACGCTGGAAA

TTGGGGAAGTTGTAGAAAAAGATACAACAGAGCTTATGGAGAAGCTAGAAGTAACCAAGCGAGAAAAGTTGGAGCTCTCAGAGAAAGTCTCTGGCCTTTC

TGAACAACTAAAGCAGACCCATTGTACCATCAATTCTCTAAGTGCAGAGGTCAGAGCCTTAAAGCAAGAGAAGGAACAGCTTTTATTGAGATGTGGAGAA

CTTGAACTCCTCGCTAACCCTAGTGGAACAGAAAATGCAGCTGTCTGCCCTGTGCAGATGAGTTCTTACCAAGCTGGGCTTGTGATGGGCAAGGTCGGGG

ATTCTGGGGGATCTATTTCTAAAATTAGTAAAGATTTGGCTGAAGAATCAAAACCAATGATAGAAGATAAAATTCCCTTTAAAGAAAGTGGGAGAGAACA

GTTGCTCTTGCCAACAAGAGCACAAAAACCGTCTCATGCGACAGTTGAACCATGTGAAAGTGAAAAACTCCAGCAAGAGCTTCATGCCCTCAAAGCCGAG

CAG GATGATCTAAGGCTGCAGATGGAGGCCCAGCGCATATGCCTTTTTGTGGTTTACTCAACTCATGCGGATCAGGTTCGTGCACACATGGAAAAGGAG

AGGGAGGAAGCTCTTTGCAGCCTTAAAGATGAGCTCATTTCCGCTCAACAGAAAAAGATCGACGAACTTCATAAAATGCACCAGTGCCAGCTCCAGAATT

TTAAAATACAGGAGACAG GTGATGAGCCTTTACAGGTGCTCATTGAACGACTTCAACAGGCAGTGTCTGAGAAATGCTTTCACATTTCAAAG ACCCTA

AACAATGTTTTCGATGAATGCTATACTCCTTTAAAATGTGAAATGAATATAGAAGAGAAAGAGAATTCTGGTGTTTACACTTCTCAAAATCAAAGCCCAG

AATTACAAGAGTATAGATACGAAGTTCAAG ACTTTCAAGAGAGCATGCAAGTCCTTCTTGGTAAAGTGACGGAAGAATGCCGCAAACTCTCAGGACTGC

AGACGCGCTTAGGCAAG ATCCATGAACAACAGACAGATGGTGTGGCACTAGAGTTTGCTGAACAAAATGCGGCAGAAGAGGAAGCAGGTCTTCTGTCAG

GTTGTTCTCAGAGTGCTTTACAGAGCACAG ATGTCAGTCTTGAGAGCAAGGTGTCTTCTCTGCCTGCGAGTGAGAAAAGCAGAGAATGTGAGAGGCAAG

TCCAAGAGTTACAGAGCCCTGTGGCTGCCGGACAGCTGCAGCTCACGGAAACCGAAGCAAACCACAGAGCAGAAACTGAGTCTTTGCAGCAGAGACTTGA

GGCTGTCAGTGAGGCTCCGGTTCAGCCAAG - UNI2216 - CTTGTCCATTGATTCTGTGGTGTTTAAAGGATCTGGTGCCCAGAAACCAGTGTACTG

TGGAAGCTGTCTAAGAGAGTGTGTGGATGGCACAGCAAAG - UNI2216 - - UNI15225 - TTTTCTGATAGATTCGAAGTGAGGCAAGAAACAA

ATATGGTTAACTTGATGGAAAAACAGTATCAAGAACGACTGGAAGAAGAAATAGCTAAG GTCATCGTATCAATGAGTATAGCATTTGCTCAACAGACGG

AACTCTCTAGATTATCTGAGGGGAAAGAAAACACTATACAATCAGAACAAGCACACACTCTATGTTCTCAAAACAAACACCAATTAAATGACATCACATC

ACAAAGTCAAGTTGGTCTTCAGACTTTTGAGGCAACGGACAAGAATTTTAAAGAAGAATTTAAACCGCTTAGCAAAGAGTTAGGCGAATATAGAAAAGCA

GTTCCTTTGTCCAGTCATGATGACCTTGATGATATACTAAAGTCAGAAGAACATGGACTGGCTATTTCAGAAGAAATATTTTCCAAAGATGAAACATTTA

TAGTGAGAAAATCT ATGCATGATGAGGTGTTGGTGTCAAGTATGGATACTTCTAGACAGCTCATCTTAAATGAACAGTTGGAAGATATGCGGCAAGAAC

TTGTGCGACAATATGAAGAACACCAGCAGGCAACAGAAATGTTGAGGCAGGCCCACATGCAACAGATGGAGAGGCAACGGGAAGACCAGGAGCAGCTCCA

AGAGGAAATCAAGAGACTCAACGAGCAGCTAGCCCAG AAATCCTCCATAGATACTGAACACGTGGTTTCAGAGAGAGAAAGGGTTCTATTAGAGGAGCT

GGAAGCACTAAAGCAGCTGCCCCTAGCTGGAAGAAAGGAGCTGTGTTGTGAGCTGCGCCACAGCAGTACGCAAACACAG GATGGACATGACGATCAGGA

AGTTGAGGAACAGACGTTAAAAGACAAGACATTGGAGAGAAGCCCTGAAGATGCTCTTCTCGATAGAAACCTGTCCAATGAAAG GTACGCTCTCAAAAA

AGCTAATAATAGACTTCTGAAGATCTTGTTAGAGGTTGTCAAGACAACATCAGCTGCTGAAGAAACAATTGGCCGCCATGTTCTTGGGATTCTGGACCGA

TCTAGTAAAGGTCAGACAGCTAGCAGCCTGCTTTGGAGGTCAGAAGCAGACGCATCCGCCACGACTTGTGCACCAGAAGATTGTGCAAGAG CTATGGAT

GAGTCCATACCCTCCTATCCTGGAACTGCCATAGCAACACATGACAGCATTTGGTCCAAAGTCACAGAGGAAGGAGCAGAGCTGTCACAGCGGCTCGTGA

GGAGTGGTTTTGCTGGGCCTGTAATAGATCCTGAAAATGAAGAACTTATGCTGAACATCAGCTCTCGACTACAAGCAGCTGTTGAAAAACTCCTAGAAGC

CATAAGTGAAACCAACACTCAG - UNI11029 - CTTGAACATGCGAAAGTTACACAGACAGAGTTGATGCGTGAGTCCTTTAGACAAAAACAAGAGG

CAACAGAGTCACTTCATTGCCTGGAAGAACTGCGAGAGCGCCTTCAGGAGGAGTCCAGGGCCAGGGAGCAGCTGGCCGAGGAGCTCAATAAAGCTGAGA 

- UNI11029 - GTGTCATTGATGGGTACTCGGATGAAAAAACTCTCTTTGAAAGGCAAATTCAAGAAAAAACCGATATTATAGAGCATCTTGAGCAGG

AGGTGTTATGTATGAACAACAGACTGCAGGAGCTAGAGTCAGACCAACGCCGGGTGGAAGAGGAACGGCAGCTGCTGTGCAGGCAGAGGGAGGCGATGAG

AGCAGAGGCTGGCCCCGTGGAGCAGC AATTTCTGCAGGAGACAGAAAAACTAATGAAGGAAAAGTTGGAAGTACAGTGTCAAGCTGAAAAAGTCCGTGG

TGACCTTCAGAAGCAAGTGAAAGCTCTAGAAATAGATGTTGAAGAACAAGTCAGTAGGTTCATAGAACTGGAGCAAGAGAAAAACGCTGAACTCACAGAT

CTAAGGCAGCAAAGCCAAGCGCTGGAGAAGCAGCTGGAAAAAATGAGAAAATTTTTAGAT GAGCAGGCCATCGATAGAGAGCACGAGAGAGATGTTTTT

CAGCAGGAGATACAGAAGCTGGAGCATCAGCTTAAGGCTGTGCCTAGAATCCAGCCTGTGAGTGAGCACCAAGCCAGAGAG - UNI7611 - GTTGAA

CAGTTAACTAATCACTTGAAAGAGAAAACAGACAGGTGCAGTGAGCTGCTGCTATCCAAGGAGCAACTGCAGCGAGACATTCAGGAGAGGAATGAGGAGA

TTGAGAAGCTGGAGTGCCGAGTGCGAGAGCTGGAGCAAGCCCTGCTGGCTAGTGCAGAGCCCTTCCCCAAG GTAGAGGACCAGAAAAGGTCTGGAGCTG

TAGAAGCAGACCCAGAATTATCCCTAGAAGTTCAGTTGCAGGTGGAGCGGGATGCTACAGACAGAAAACAGAAAGAG ATCACCAACCTAGAAGAACAAT

TAGAACAGTTTCGGGAAGAACTGGAAAATAAGAACGATGAGGTCCAGGAGCTCCTCATGCAGCTGGAGATTCAGAGAAAAGAGTCCACCACCCGCCTGCA

GGAGCTGCAGCAGGAAAACAGGCTATTTAAG GATGAAATAGAAAAACTTGGGTTTGCCATGAAGGAATCTGATTCTGTATCTACTCGGGATCAGCCCAT

GCTGTTTGGCAAATTTGCACAGCTAATACAAGAAAAGGAGATTGAAATTGACCGGTTAAATGAGCAGTTTATAAAACTGCAGCAGCAACTTAAACTCACA

ACGGATAACAAG GTCATTGAAGAACAAAAGGAACAGATACAAGATCTGGAAACCCAGATTGAACGTTTGATGAGTGAGCGAGAACATGAGAAGAAACAG

AGAGAGGAAGAAGTAGAGCAGCTCACTGGGGTGGTTGAGAAACTGCAGCAGGAGGTGGTCAGCACTGAACAGCAGAGAGAGGGTGCCAGGACCCTCCCAG

AAGATGAGGAGAGCTTTAAACATCAGCTGGACAAGGTGACTGCTGAAAAGCTGGTTTTAGAGCAACAAGTAGAAACCACCAACCAGGTAATGACGCACAT

GAACAATGTCCTTAAAGAAATCAATTTCAAAATGGATCAGATAACACAATCACTGTGCAACTTGAATAAAGAATGTGCCAGCAATGAAGAACTTCCAAGT

CTACCTAAGGAAAGTGTCCACATGACTGTGCATGAGCTAGGCAGTGACAATCTGCAGCCAGAAGATGCCCCTGCCCAGGATGTGACCAAACCTCTAGAAA

AACAGACCTCCCTTACGCGTCTTCAGAAAAGCCCTGAAGCTTCTAGAACACAAGAAATAGAGTCCCTGGCAAGCTCTGTTGGCGCCAAGGACGTTGAGCT

TACCCAGTGTCGTGAACAAACAGAAACCATACAAGAGCAAGCCCAGTCTGAGACAGACAGGCTTCAGAAGAAGCTCACAGACCTGCAGAGAAGCCTTGAG

AAGTTCGCCGCTGCACTGGTCAGTCAGGTCCAAATGGAGGCAGCTCAGGAGTATGTGCCGTTCCACCAAGAAAAGCAGCCGGTTTCATCAGCACCCGGAA

GCACAGATATACAGAATGCAAATGGTCTGACTGGAGCCAGCACGGAGTCACTCATCCCCACAGTGACCCTGAGGCTAGCAGAGGTGGAGAGCCGTGTAGC

TGAAGTGCACAGTGGTACAATGTCAGAAAAACTTGTGGGAATTGTGGGGGGAAATGCTTCAGAGACAGAAAAGAGAGTTATAGAGCTACAGAAGCTATTG

GAGGAGGCCGAGGAAAGACCGGAAGAGGGAGGAGAACAAAGCTCTCGGGATGGGGAG GTAAGAGAAAGCTACATGACATCACTGCAGAAGGACTTAGGC

CAAGTTAAAGATCCACTCACAGAAGCCAAGGAGAAACTATCCTACTCCTTAGAAAAAGAAAAGAGGACTGGAGAACAGGAAAGCAGAGAGGCCCCCATAC

CAGAGCCACCTTCTGTTGAAGTAGGTGGCTGCTCTGGGCTCACAGAGAGAACAGACAAGGTGAGCAGCAGCGGCAATCAGACCCTGCAGATCCTTCTTAG

AGACGCAGCGATTCAGACTGACTTACAGAGTGAGAGCTCCCAAGAAGAGGTCAGAGATACCATCAATCAACTTACTAAAAAAATGGAGCACATACAAGAG

CTACATGCCGCTGAGATTTTGGATATGGAATCCAGACATATTTTAGAAACTGAGTCTTTGAAGAAAGAACATTATGTTGCGATCCAGTTACTGACTAAGG

AATGCGAGACCCTGAAGGAGATGACCCAGTGTCTGAGATGCAAAGAG GGATCCTCCATTCCTGAATTGGCAGATTCTGTTGCTTATCAAAGTAGAGAAG

TCTATTCCAGTG ATTCTGAATCAGACTGGGGTCAAAGCCAGGGATTTGATACAGCAATAGAAGGCCGAGAAGAAGGGGAAACATCAGCAGATTTATTTC

CAAAGAAAATAAAG GGGTTAGTGAAGGCTGTCCACAGTGAGGGCATGCAGGTGCTCTCTCTCTCCAGTCCCCTCTGTGATGATGGAGAGGACCGTTCCA

TTCAGCAGCTTTCGGAATCTTGGCTGAAAGAGAGACAAGCTTACCTCAATACCATCTCATCTCTTAAAGATTTAATTTCTAAGATGCAAGTGCGAAGAGA

AACTGAG GTCTATGACAGGTGTCACCTCTCAGACTGGCGAGGTGAACTTCTGCTTGCCTGTCAGCGTGTTTTCATAAAGGAACGTAGTGTTTTACTAGC

TACATTCCAAACTGAGCTGACATCTCTCAGCACTAGAGATGTGGATGGATTGTTAAACTCTTTGGAACAGAGAATACAAGAGCAG GGCATTGAATATCA

CACAGCAATGGACTGCCTGCAGAAAGCAGATAGGAGGAGTTTACTGGCTGAAATCGAAGATCTGCGTGCTCAGATTAATGGCGGGAAAATGACTCTGGAA

AGAGAACAAGGAACTGAGAAAAGCAGCCAAG AACTCCTGGACTGCAGTATGCAGCAGAAGCAGTCGCTGGAAATGCAACTGGAACTCAGCAGCCTGAGA

GACAGAGCAGCCGAGCTGCAGGAACAGCTGAGTTCGGAAAAGATGGTGGTTGCGGAACTAAAAAGTGAACTTGCACAGGCAAAACTGGAATTGGGAACAA

CACTCAAGGCCCAGCATAAGCGCCTAAAGGAATTAGAAGCATTCAG GTCGGAAGTTAAGGAGAAGACGGATGAAATCCATTTCCTTAGTGATACATTAG

CAAGGGAACAGAAGAATTCATTAGAGCTGCAGTGGGCTTTGGAAAAGGAAAAGGCCAGGTCGGGACACCACGAGGGACGGGAAAAAGAAGAACTCGAG G

ATCTGAAATTTTCACTTGAGGATCAGAAACGGAGAAATACACAGTTAAACCTCCTTTTGGAACAACAGAAGCAGCTACTAAATGAATCTCAGCAGAAAAT

AGAGTCACAGAAAATGTTGCATGATGCCCAGTTATCAGAAGAACAAGGCCGCAACTTAGGGCTTCAAGCTCTCCTGGAGTCAGAGCAAGTTAGGATTCAG

GAGATGAAGAGCACACTAGACAAGGAACGGGAGCTGTATGCCCAGTTGCAGAGCCGTGAAGATGGCGGGCAGCCCCCGCCAGCCTTGCCTTCTGAGGACC

TACTTAAAGAGCTACAGAAACAACTGGAGGAAAAACACAGCCGCATAGTAGAACTGTTAAGTGAAACTGAAAAATATAAACTAGATTCCTTGCAAACAAG

GCAACAGATGGAAAAGGACAGGCAGGTTCATCAGAAGACACTGCAGACAGAACAGGAGGCAAACACCCAGGGCCAAAAGAAAATGCAGGAGCTGCAGTCC

AAAGTGGAAGAGCTGCAGCGCCAGCTCCAGGAGAAAAGGCAGCAGGTGTACAAGCTAGACCTGGAGGGAAAGCGACTGCAAGGGCTTATGCAGGAATTCC

AAAAGCAGGAGCTGGAGCCGGAGGAGAAACCGGGAAGCAGAGGCCTTGTGGATCAGAATCTGAATGAG CCAGCCACCTGGAACTTCACTGATGATCGGA

CTAGAAATTGGGTTCTTCAACAGAAAATGGGAGAGGCCAAAGACAGGAACTTCACAAAGTTGATTGAAATAAACGGAGGAGAACTTGACCATAATCATGA

CTTGGAAATGATCAGACAGACACTCCAGCATGTGGCTTCAAAACTTCAGCATGTAGCCCAGAAAGCCTGCAGCAG GCTGCAGTTTGAAACAGCCGGTGA

TGATGCATTTATTTGGATTCAGGAGAATATTGATGGAATTATTTTGCAACTACAGAAACTAACTGGCCAGCCAGGTGATGAG CACAGCTTAGGACCCCC

CAGTTCTTCCTGTGGCTCCTTAACTGAAAGCCTAATGAGACAAAATACTGAGTTAACAAGACTTATCAACCAACTAACAGAAGAAAAGAACACCTTACGG

AGCATTGTCATAAAGCTGGAGGAGCTGAACAGGTGCTACTGGCACACAGGAGCCAGCAGAGACTGT - UNI32333 - TGTTCTAGGTTCTCATTTAT

TGATCCAGCTGACATCGAAGCCATCATTGCTTCAGAAAAGGAAGTCTGGAACAGAGAAAAGTTATCTCTTCAGAAAGCCTTGAAGAGGGCAGAAGCAAAA

GTGTACAAGCTAAAAGCTGAACTACGAAACGATGCCTTGCTTCGGAATCTGGGCCCTGACACTGATCATGCTGCCCTGCAG AAAATTTATAATAAATAC

TTGAGAGCTTCAAGTTTCCGGAAAGCTCTCATATATCAGAAAAAATACCTGCTGCTGCTCCTGGGGGGATTCCAGGAGTGTGAAGACGTCACCCTGGGGG

TTCTTGCCCGAATGGGGGGACACCTAGCCTTGAAAGATTCCAAGACCATCACCAACCACCCGAAGGCATTCAGCAGGTTTCGCTCCGCCGTCAGAGTGTC

CATTGCGATTTCAAG AATGAAATTTTTGGTGCGGCGGTGGCAGCAAGTGACAAGTACTAGCTCCATCAATATTAACAGGGATGGATTTGGACTGAGTCC

AG GCATTGAAAAGACTGATCCATTCTATCATTCTCCTGGTGGGCTGCAGCTCTATGGAGAACCAAGACACACAATGTACCGTTCAAGATTTGATCTGGA

CTATCCTCGGTCTCTCTTACCATTGCAGAATAG GTACCCGGGTACTCCAGGAGACTTAAATTCTATTTCAATGGCTTCTTCTCAACTTCACCAGTACAA

TCCTGATAAATCTCTGACAGATTACGTCACTCGGCTAGAGGCGCTGAGAAGGCGACTTGGAGCTATACAGTCAG GGTCCACTACTCAATTTCACTTTGG

CATGAGGAGATAATCCGTTGAAACATTAATTGAATATTAAATAGATTCCCTTTTGTAAATCAATGGCTCTTTTGTGCTTTTGTATTGTGAATATTCGATG

GGACCAATACATGCACAGCTTATGATTGTATACAAATCCTTAGCAGCAGCACATGAAGACAAACTGGAGTTTGTGTATATAAGCAATGTGTGTGTGTTCA

TGCACAGTAATCATTAAATTACATGTATATTTGTGGAATGCTAATTTAAGTGATTAAATTATAAACTTTGTGTATTTATCAGGTGGGTGAAAAGATTAAA

CTTTTTCAAATGACAGTGCTGCTGGACGAGTACCTTGCGGTGCCCTGCGCTTTTCTTACAAAGCTACTGAAGTTACATGTTTCTGCTTAATATATTTGCT

ACTGGTGATGAAGACAACATATCACTTGTAGAGACCTATTTTTGTATAATGGTCAAAGTTTTGAACTTTATGGGTATTTTGTCAAGTACTGAAATAAAAA

GACCTCACCATTTTCACCTTA
Translation
MEDEERQRKLAAGKAK - UNI30740 - LARFRQRKAQYDGDIPKKQKKKRTSSSKHDSSLHTDQQSGELCSESSQRVDLAGNPDCSGPERKHGQVFS

AE PESEISTTADECSSE INGCNSVMKPRKPTDPLR EEEFSLDDSSSEQGAQSSQTCLQMVEKELAEKQHDIEELTQELEEMRASFGTEGLKQ LQEF

EAAIKQRDGIITQLTANLQQARREKDDTMVEFLELTEQSQKLQIQFQH - UNI35433 - LQANETLQNSTLSRTATDLLQAKRQIFTQQQQLQDYQK

KEEDLQAQISFLQEKLRAFEM EKDRKIENLNAKEIQEKQALIDELNTRVVEEEKKTVELKNKVTTADELLGGLHEQLTQRNQEIQSLKLELGNSQQNER

KCSEEIKELMRTVEELQKRNLKDSWLETSAVRRVEQETQRKLSHLQAELDEMYGKQIVQMKQELINQHMSQIEELKSQHKREMENTLKSDTNAAISKEQV

NLMNAAINELNVRLQETHAQKEELKGELGVVLGEKSALQSQSNDLLEEVRFLREQVQKARQTIAEQENRLSEARKSLSTVEDLKAEIVAASESRKELELK

HEAEITNYKIKLEML       - UNI2216 -  - UNI2216 - - UNI15225 -        - UNI11029 -  - UNI11029 -    - U

NI7611 -                  - UNI32333 -      
Transcript ENSMUST00000044492
Sequence
GGTCAAGCCGGGCGCGCACAAGCACCTGCCGGGCCACGCTCGCGGCTGCGCCGGCCGCCCGCCCGCCCGCTCCGCCCCGCCGGCCGCCGTGTGTTTACGT

GGAGACGAAGATGGCGGCGGTGACCGCGGGGCCCGTGCAGGCCGGCACGAGTCGCCGGTGAGCGCCCAGCGTGTCCCGGGTGGCCACGGAGCTCTGTCCG

CCTCTTTCTAAACAGATCTTTCCTCTCCACTGCGTCCCAGCCTACCCTGCAGACGCCATGGAGGACGAGGAGAGGCAAAGGAAGCTGGCAGCCGGCAAGG

CGAAG - UNI30740 - CTTGCTCGGTTTCGACAAAGAAAAGCCCAATATGATGGGGACATTCCGAAGAAACAGAAGAAGAAGAGGACGTCAAGCTCT

AAACATGATTCAAGCTTACATACTGATCAACAGAGTGGTGAGCTCTGCTCGGAAAGTTCTCAGAGGGTAGACTTAGCCGGGAATCCTGATTGCTCCGGGC

CAGAGAGAAAGCACGGCCAGGTCTTCTCTGCTGAA CCTGAAAGTGAAATTTCTACCACTGCAGATGAATGTAGCTCGGAG GAAGAAGAATTTTCACTT

GATGACTCCTCCTCTGAGCAAGGAGCTCAGTCCAGTCAGACCTGTCTTCAGATGGTAGAAAAGGAGTTGGCCGAGAAGCAGCATGATATTGAAGAGTTGA

CTCAGGAGTTGGAAGAGATGAGGGCCAGCTTTGGGACCGAAGGGCTGAAGCAG TTACAAGAATTTGAAGCCGCCATTAAACAGCGAGACGGCATCATAA

CTCAGCTCACAGCTAACTTGCAGCAAGCAAGGAGAGAGAAGGATGACACGATGGTAGAATTCTTAGAGCTGACAGAACAAAGTCAAAAACTGCAGATTCA

GTTCCAGCAC - UNI35433 - TTACAGGCTAATGAAACTTTGCAAAACAGCACTCTCAGCCGAACTGCGACAGATTTACTGCAGGCCAAACGACAGA

TCTTCACTCAACAGCAACAGCTGCAAGATTATCAGAAAAAGGAGGAGGACCTCCAAGCGCAGATTTCTTTTTTACAAGAGAAATTAAGAGCGTTTGAAAT

G GAAAAAGACAGAAAAATAGAAAACTTAAATGCAAAAGAAATACAGGAGAAGCAGGCACTCATTGATGAGTTGAATACAAGAGTAGTAGAAGAAGAGAA

GAAAACTGTTGAGTTAAAGAATAAAGTAACAACTGCTGATGAGTTACTAGGAGGGTTACACGAACAGCTTACACAGAGGAATCAGGAGATCCAAAGCCTG

AAACTAGAACTGGGCAACTCTCAGCAGAACGAGCGGAAGTGTTCAGAGGAAATCAAAGAGCTAATGAGGACAGTTGAAGAACTCCAGAAGAGAAACCTTA

AAGATAGCTGGCTGGAAACTAGCGCCGTGCGAAGGGTGGAACAGGAAACCCAACGGAAATTAAGCCATCTCCAAGCAGAGCTGGATGAGATGTATGGGAA

GCAAATAGTGCAAATGAAACAAGAGTTAATAAATCAGCACATGTCTCAGATAGAGGAGCTCAAATCCCAACATAAGAGAGAAATGGAGAACACCTTAAAG

TCGGATACAAATGCTGCCATCAGTAAAGAACAAGTAAATTTAATGAATGCCGCCATAAATGAACTCAATGTAAGATTACAGGAGACTCATGCTCAAAAGG

AGGAACTCAAGGGAGAGCTTGGCGTAGTTCTGGGAGAAAAGTCAGCTTTGCAAAGTCAGTCTAATGACCTCTTAGAAGAGGTAAGGTTTTTAAGAGAGCA

AGTTCAGAAAGCTAGGCAGACAATCGCAGAGCAAGAGAACAGGCTGAGTGAGGCGCGCAAGTCCCTGAGCACAGTGGAAGACCTAAAAGCTGAGATCGTG

GCTGCCTCCGAATCCAGAAAGGAACTCGAGCTCAAGCATGAAGCCGAGATTACAAATTATAAAATAAAACTTGAAATGCTAGAAAAAGAAAAAAATGCTG

TGCTAGACAGAATGGCGGAATCCCAAGAAGCAGAGCTGGAGAGGCTGAGAACACAGCTCCTCTTTAGTCATGAGGAAGAATTGTCTAAACTAAAAGAAGA

TTTAGAAGTAGAACATCGAATAAATATTGAAAAACTTAAAGATAATTTAGGCATTCACTACAAGCAACAGATAGACGGCTTACAGAATGAAATGAATAGG

AAGATGGAAAGTATGCAGTGTGAAACAGACAACCTGATAACCCAGCAGAATCAGTTAATTCTGGAAAATTCAAAGCTAAGAGATTTACAGGAATGCCTTG

TTAACTCAAAATCAGAAGAAATGAATCTTCAAATCAATGAACTGCAAAAAGAGATTGAAATCCTCAAACAAGAAGAAAAGGAGAAAGGTACCCTTGAGCA

GGAAGTCCAGGAGTTGCAACTTAAAACTGAACAATTGGAGAAACAGCTGAAGGAGAAGGAAGATGACCTTCAAGAAAAATGTGCACAGCTGGACGCAGAG

AACAACATTCTCAAAGAGGAGAAGAGAGTCCTTGAAGACAAGTTGAAAATGTACAGTCCTTCGGAACAAGAGGAGAGATCCATTGCCGTAGATCCCAGCA

CAAGCAAGTCGGCAGACTCGAGGTGGCAAAAAGAAGTAGCGATGCTGAGGAAGGAGACCGAGGACCTTCAACAACAATGCCTTTATCTAAATGAAGAGAT

CGAGAAGCAAAGGAATACGTTTGCGTTTGCTGAAAAGAACTTTGAAGTTAACTATCAAGAGTTACAGAGGGAGTATACTTGTCTGCTCAAGATAAGAGAT

GATTTAGAGGCCACACAGACCAAGCAGGCATTGGAATATGAGAGCAAGCTGAGAGCGCTGGAGGAAGAGCTCCTTTCGAAAAGAGGAAATCCAGCCGCGC

CAAAGGGGAAGAGTTCTGGAATTTTCCCATCTGAGACGCTGGAAATTGGGGAAGTTGTAGAAAAAGATACAACAGAGCTTATGGAGAAGCTAGAAGTAAC

CAAGCGAGAAAAGTTGGAGCTCTCAGAGAAAGTCTCTGGCCTTTCTGAACAACTAAAGCAGACCCATTGTACCATCAATTCTCTAAGTGCAGAGGTCAGA

GCCTTAAAGCAAGAGAAGGAACAGCTTTTATTGAGATGTGGAGAACTTGAACTCCTCGCTAACCCTAGTGGAACAGAAAATGCAGCTGTCTGCCCTGTGC

AGATGAGTTCTTACCAAGCTGGGCTTGTGATGGGCAAGGTCGGGGATTCTGGGGGATCTATTTCTAAAATTAGTAAAGATTTGGCTGAAGAATCAAAACC

AATGATAGAAGATAAAATTCCCTTTAAAGAAAGTGGGAGAGAACAGTTGCTCTTGCCAACAAGAGCACAAAAACCGTCTCATGCGACAGTTGAACCATGT

GAAAGTGAAAAACTCCAGCAAGAGCTTCATGCCCTCAAAGCCGAGCAG GATGATCTAAGGCTGCAGATGGAGGCCCAGCGCATATGCCTTTTTGTGGTT

TACTCAACTCATGCGGATCAGGTTCGTGCACACATGGAAAAGGAGAGGGAGGAAGCTCTTTGCAGCCTTAAAGATGAGCTCATTTCCGCTCAACAGAAAA

AGATCGACGAACTTCATAAAATGCACCAGTGCCAGCTCCAGAATTTTAAAATACAGGAGACAG GTGATGAGCCTTTACAGGTGCTCATTGAACGACTTC

AACAGGCAGTGTCTGAGAAATGCTTTCACATTTCAAAG ACCCTAAACAATGTTTTCGATGAATGCTATACTCCTTTAAAATGTGAAATGAATATAGAAG

AGAAAGAGAATTCTGGTGTTTACACTTCTCAAAATCAAAGCCCAGAATTACAAGAGTATAGATACGAAGTTCAAG ACTTTCAAGAGAGCATGCAAGTCC

TTCTTGGTAAAGTGACGGAAGAATGCCGCAAACTCTCAGGACTGCAGACGCGCTTAGGCAAG ATCCATGAACAACAGACAGATGGTGTGGCACTAGAGT

TTGCTGAACAAAATGCGGCAGAAGAGGAAGCAGGTCTTCTGTCAGGTTGTTCTCAGAGTGCTTTACAGAGCACAG ATGTCAGTCTTGAGAGCAAGGTGT

CTTCTCTGCCTGCGAGTGAGAAAAGCAGAGAATGTGAGAGGCAAGTCCAAGAGTTACAGAGCCCTGTGGCTGCCGGACAGCTGCAGCTCACGGAAACCGA

AGCAAACCACAGAGCAGAAACTGAGTCTTTGCAGCAGAGACTTGAGGCTGTCAGTGAGGCTCCGGTTCAGCCAAG - UNI2216 - CTTGTCCATTGA

TTCTGTGGTGTTTAAAGGATCTGGTGCCCAGAAACCAGTGTACTGTGGAAGCTGTCTAAGAGAGTGTGTGGATGGCACAGCAAAG - UNI2216 - - 

UNI15225 - TTTTCTGATAGATTCGAAGTGAGGCAAGAAACAAATATGGTTAACTTGATGGAAAAACAGTATCAAGAACGACTGGAAGAAGAAATAGC

TAAG GTCATCGTATCAATGAGTATAGCATTTGCTCAACAGACGGAACTCTCTAGATTATCTGAGGGGAAAGAAAACACTATACAATCAGAACAAGCACA

CACTCTATGTTCTCAAAACAAACACCAATTAAATGACATCACATCACAAAGTCAAGTTGGTCTTCAGACTTTTGAGGCAACGGACAAGAATTTTAAAGAA

GAATTTAAACCGCTTAGCAAAGAGTTAGGCGAATATAGAAAAGCAGTTCCTTTGTCCAGTCATGATGACCTTGATGATATACTAAAGTCAGAAGAACATG

GACTGGCTATTTCAGAAGAAATATTTTCCAAAGATGAAACATTTATAGTGAGAAAATCT ATGCATGATGAGGTGTTGGTGTCAAGTATGGATACTTCTA

GACAGCTCATCTTAAATGAACAGTTGGAAGATATGCGGCAAGAACTTGTGCGACAATATGAAGAACACCAGCAGGCAACAGAAATGTTGAGGCAGGCCCA

CATGCAACAGATGGAGAGGCAACGGGAAGACCAGGAGCAGCTCCAAGAGGAAATCAAGAGACTCAACGAGCAGCTAGCCCAG AAATCCTCCATAGATAC

TGAACACGTGGTTTCAGAGAGAGAAAGGGTTCTATTAGAGGAGCTGGAAGCACTAAAGCAGCTGCCCCTAGCTGGAAGAAAGGAGCTGTGTTGTGAGCTG

CGCCACAGCAGTACGCAAACACAG GATGGACATGACGATCAGGAAGTTGAGGAACAGACGTTAAAAGACAAGACATTGGAGAGAAGCCCTGAAGATGCT

CTTCTCGATAGAAACCTGTCCAATGAAAG GTACGCTCTCAAAAAAGCTAATAATAGACTTCTGAAGATCTTGTTAGAGGTTGTCAAGACAACATCAGCT

GCTGAAGAAACAATTGGCCGCCATGTTCTTGGGATTCTGGACCGATCTAGTAAAGGTCAGACAGCTAGCAGCCTGCTTTGGAGGTCAGAAGCAGACGCAT

CCGCCACGACTTGTGCACCAGAAGATTGTGCAAGAG CTATGGATGAGTCCATACCCTCCTATCCTGGAACTGCCATAGCAACACATGACAGCATTTGGT

CCAAAGTCACAGAGGAAGGAGCAGAGCTGTCACAGCGGCTCGTGAGGAGTGGTTTTGCTGGGCCTGTAATAGATCCTGAAAATGAAGAACTTATGCTGAA

CATCAGCTCTCGACTACAAGCAGCTGTTGAAAAACTCCTAGAAGCCATAAGTGAAACCAACACTCAG - UNI11029 - CTTGAACATGCGAAAGTTA

CACAGACAGAGTTGATGCGTGAGTCCTTTAGACAAAAACAAGAGGCAACAGAGTCACTTCATTGCCTGGAAGAACTGCGAGAGCGCCTTCAGGAGGAGTC

CAGGGCCAGGGAGCAGCTGGCCGAGGAGCTCAATAAAGCTGAGA - UNI11029 - GTGTCATTGATGGGTACTCGGATGAAAAAACTCTCTTTGAAA

GGCAAATTCAAGAAAAAACCGATATTATAGAGCATCTTGAGCAGGAGGTGTTATGTATGAACAACAGACTGCAGGAGCTAGAGTCAGACCAACGCCGGGT

GGAAGAGGAACGGCAGCTGCTGTGCAGGCAGAGGGAGGCGATGAGAGCAGAGGCTGGCCCCGTGGAGCAGC AATTTCTGCAGGAGACAGAAAAACTAAT

GAAGGAAAAGTTGGAAGTACAGTGTCAAGCTGAAAAAGTCCGTGGTGACCTTCAGAAGCAAGTGAAAGCTCTAGAAATAGATGTTGAAGAACAAGTCAGT

AGGTTCATAGAACTGGAGCAAGAGAAAAACGCTGAACTCACAGATCTAAGGCAGCAAAGCCAAGCGCTGGAGAAGCAGCTGGAAAAAATGAGAAAATTTT

TAGAT GAGCAGGCCATCGATAGAGAGCACGAGAGAGATGTTTTTCAGCAGGAGATACAGAAGCTGGAGCATCAGCTTAAGGCTGTGCCTAGAATCCAGC

CTGTGAGTGAGCACCAAGCCAGAGAG - UNI7611 - GTTGAACAGTTAACTAATCACTTGAAAGAGAAAACAGACAGGTGCAGTGAGCTGCTGCTAT

CCAAGGAGCAACTGCAGCGAGACATTCAGGAGAGGAATGAGGAGATTGAGAAGCTGGAGTGCCGAGTGCGAGAGCTGGAGCAAGCCCTGCTGGCTAGTGC

AGAGCCCTTCCCCAAG GTAGAGGACCAGAAAAGGTCTGGAGCTGTAGAAGCAGACCCAGAATTATCCCTAGAAGTTCAGTTGCAGGTGGAGCGGGATGC

TACAGACAGAAAACAGAAAGAG ATCACCAACCTAGAAGAACAATTAGAACAGTTTCGGGAAGAACTGGAAAATAAGAACGATGAGGTCCAGGAGCTCCT

CATGCAGCTGGAGATTCAGAGAAAAGAGTCCACCACCCGCCTGCAGGAGCTGCAGCAGGAAAACAGGCTATTTAAG GATGAAATAGAAAAACTTGGGTT

TGCCATGAAGGAATCTGATTCTGTATCTACTCGGGATCAGCCCATGCTGTTTGGCAAATTTGCACAGCTAATACAAGAAAAGGAGATTGAAATTGACCGG

TTAAATGAGCAGTTTATAAAACTGCAGCAGCAACTTAAACTCACAACGGATAACAAG GTCATTGAAGAACAAAAGGAACAGATACAAGATCTGGAAACC

CAGATTGAACGTTTGATGAGTGAGCGAGAACATGAGAAGAAACAGAGAGAGGAAGAAGTAGAGCAGCTCACTGGGGTGGTTGAGAAACTGCAGCAGGAGG

TGGTCAGCACTGAACAGCAGAGAGAGGGTGCCAGGACCCTCCCAGAAGATGAGGAGAGCTTTAAACATCAGCTGGACAAGGTGACTGCTGAAAAGCTGGT

TTTAGAGCAACAAGTAGAAACCACCAACCAGGTAATGACGCACATGAACAATGTCCTTAAAGAAATCAATTTCAAAATGGATCAGATAACACAATCACTG

TGCAACTTGAATAAAGAATGTGCCAGCAATGAAGAACTTCCAAGTCTACCTAAGGAAAGTGTCCACATGACTGTGCATGAGCTAGGCAGTGACAATCTGC

AGCCAGAAGATGCCCCTGCCCAGGATGTGACCAAACCTCTAGAAAAACAGACCTCCCTTACGCGTCTTCAGAAAAGCCCTGAAGCTTCTAGAACACAAGA

AATAGAGTCCCTGGCAAGCTCTGTTGGCGCCAAGGACGTTGAGCTTACCCAGTGTCGTGAACAAACAGAAACCATACAAGAGCAAGCCCAGTCTGAGACA

GACAGGCTTCAGAAGAAGCTCACAGACCTGCAGAGAAGCCTTGAGAAGTTCGCCGCTGCACTGGTCAGTCAGGTCCAAATGGAGGCAGCTCAGGAGTATG

TGCCGTTCCACCAAGAAAAGCAGCCGGTTTCATCAGCACCCGGAAGCACAGATATACAGAATGCAAATGGTCTGACTGGAGCCAGCACGGAGTCACTCAT

CCCCACAGTGACCCTGAGGCTAGCAGAGGTGGAGAGCCGTGTAGCTGAAGTGCACAGTGGTACAATGTCAGAAAAACTTGTGGGAATTGTGGGGGGAAAT

GCTTCAGAGACAGAAAAGAGAGTTATAGAGCTACAGAAGCTATTGGAGGAGGCCGAGGAAAGACCGGAAGAGGGAGGAGAACAAAGCTCTCGGGATGGGG

AG GTAAGAGAAAGCTACATGACATCACTGCAGAAGGACTTAGGCCAAGTTAAAGATCCACTCACAGAAGCCAAGGAGAAACTATCCTACTCCTTAGAAA

AAGAAAAGAGGACTGGAGAACAGGAAAGCAGAGAGGCCCCCATACCAGAGCCACCTTCTGTTGAAGTAGGTGGCTGCTCTGGGCTCACAGAGAGAACAGA

CAAGGTGAGCAGCAGCGGCAATCAGACCCTGCAGATCCTTCTTAGAGACGCAGCGATTCAGACTGACTTACAGAGTGAGAGCTCCCAAGAAGAGGTCAGA

GATACCATCAATCAACTTACTAAAAAAATGGAGCACATACAAGAGCTACATGCCGCTGAGATTTTGGATATGGAATCCAGACATATTTTAGAAACTGAGT

CTTTGAAGAAAGAACATTATGTTGCGATCCAGTTACTGACTAAGGAATGCGAGACCCTGAAGGAGATGACCCAGTGTCTGAGATGCAAAGAG GGATCCT

CCATTCCTGAATTGGCAGATTCTGTTGCTTATCAAAGTAGAGAAGTCTATTCCAGTG ATTCTGAATCAGACTGGGGTCAAAGCCAGGGATTTGATACAG

CAATAGAAGGCCGAGAAGAAGGGGAAACATCAGCAGATTTATTTCCAAAGAAAATAAAG GGGTTAGTGAAGGCTGTCCACAGTGAGGGCATGCAGGTGC

TCTCTCTCTCCAGTCCCCTCTGTGATGATGGAGAGGACCGTTCCATTCAGCAGCTTTCGGAATCTTGGCTGAAAGAGAGACAAGCTTACCTCAATACCAT

CTCATCTCTTAAAGATTTAATTTCTAAGATGCAAGTGCGAAGAGAAACTGAG GTCTATGACAGGTGTCACCTCTCAGACTGGCGAGGTGAACTTCTGCT

TGCCTGTCAGCGTGTTTTCATAAAGGAACGTAGTGTTTTACTAGCTACATTCCAAACTGAGCTGACATCTCTCAGCACTAGAGATGTGGATGGATTGTTA

AACTCTTTGGAACAGAGAATACAAGAGCAG GGCATTGAATATCACACAGCAATGGACTGCCTGCAGAAAGCAGATAGGAGGAGTTTACTGGCTGAAATC

GAAGATCTGCGTGCTCAGATTAATGGCGGGAAAATGACTCTGGAAAGAGAACAAGGAACTGAGAAAAGCAGCCAAG AACTCCTGGACTGCAGTATGCAG

CAGAAGCAGTCGCTGGAAATGCAACTGGAACTCAGCAGCCTGAGAGACAGAGCAGCCGAGCTGCAGGAACAGCTGAGTTCGGAAAAGATGGTGGTTGCGG

AACTAAAAAGTGAACTTGCACAGGCAAAACTGGAATTGGGAACAACACTCAAGGCCCAGCATAAGCGCCTAAAGGAATTAGAAGCATTCAG GTCGGAAG

TTAAGGAGAAGACGGATGAAATCCATTTCCTTAGTGATACATTAGCAAGGGAACAGAAGAATTCATTAGAGCTGCAGTGGGCTTTGGAAAAGGAAAAGGC

CAGGTCGGGACACCACGAGGGACGGGAAAAAGAAGAACTCGAG GATCTGAAATTTTCACTTGAGGATCAGAAACGGAGAAATACACAGTTAAACCTCCT

TTTGGAACAACAGAAGCAGCTACTAAATGAATCTCAGCAGAAAATAGAGTCACAGAAAATGTTGCATGATGCCCAGTTATCAGAAGAACAAGGCCGCAAC

TTAGGGCTTCAAGCTCTCCTGGAGTCAGAGCAAGTTAGGATTCAGGAGATGAAGAGCACACTAGACAAGGAACGGGAGCTGTATGCCCAGTTGCAGAGCC

GTGAAGATGGCGGGCAGCCCCCGCCAGCCTTGCCTTCTGAGGACCTACTTAAAGAGCTACAGAAACAACTGGAGGAAAAACACAGCCGCATAGTAGAACT

GTTAAGTGAAACTGAAAAATATAAACTAGATTCCTTGCAAACAAGGCAACAGATGGAAAAGGACAGGCAGGTTCATCAGAAGACACTGCAGACAGAACAG

GAGGCAAACACCCAGGGCCAAAAGAAAATGCAGGAGCTGCAGTCCAAAGTGGAAGAGCTGCAGCGCCAGCTCCAGGAGAAAAGGCAGCAGGTGTACAAGC

TAGACCTGGAGGGAAAGCGACTGCAAGGGCTTATGCAGGAATTCCAAAAGCAGGAGCTGGAGCCGGAGGAGAAACCGGGAAGCAGAGGCCTTGTGGATCA

GAATCTGAATGAG CCAGCCACCTGGAACTTCACTGATGATCGGACTAGAAATTGGGTTCTTCAACAGAAAATGGGAGAGGCCAAAGACAGGAACTTCAC

AAAGTTGATTGAAATAAACGGAGGAGAACTTGACCATAATCATGACTTGGAAATGATCAGACAGACACTCCAGCATGTGGCTTCAAAACTTCAGCATGTA

GCCCAGAAAGCCTGCAGCAG GCTGCAGTTTGAAACAGCCGGTGATGATGCATTTATTTGGATTCAGGAGAATATTGATGGAATTATTTTGCAACTACAG

AAACTAACTGGCCAGCCAGGTGATGAG CACAGCTTAGGACCCCCCAGTTCTTCCTGTGGCTCCTTAACTGAAAGCCTAATGAGACAAAATACTGAGTTA

ACAAGACTTATCAACCAACTAACAGAAGAAAAGAACACCTTACGGAGCATTGTCATAAAGCTGGAGGAGCTGAACAGGTGCTACTGGCACACAGGAGCCA

GCAGAGACTGT - UNI32333 - TGTTCTAGGTTCTCATTTATTGATCCAGCTGACATCGAAGCCATCATTGCTTCAGAAAAGGAAGTCTGGAACAGA

GAAAAGTTATCTCTTCAGAAAGCCTTGAAGAGGGCAGAAGCAAAAGTGTACAAGCTAAAAGCTGAACTACGAAACGATGCCTTGCTTCGGAATCTGGGCC

CTGACACTGATCATGCTGCCCTGCAG AAAATTTATAATAAATACTTGAGAGCTTCAAGTTTCCGGAAAGCTCTCATATATCAGAAAAAATACCTGCTGC

TGCTCCTGGGGGGATTCCAGGAGTGTGAAGACGTCACCCTGGGGGTTCTTGCCCGAATGGGGGGACACCTAGCCTTGAAAGATTCCAAGACCATCACCAA

CCACCCGAAGGCATTCAGCAGGTTTCGCTCCGCCGTCAGAGTGTCCATTGCGATTTCAAG AATGAAATTTTTGGTGCGGCGGTGGCAGCAAGTGACAAG

TACTAGCTCCATCAATATTAACAGGGATGGATTTGGACTGAGTCCAG GCATTGAAAAGACTGATCCATTCTATCATTCTCCTGGTGGGCTGCAGCTCTA

TGGAGAACCAAGACACACAATGTACCGTTCAAGATTTGATCTGGACTATCCTCGGTCTCTCTTACCATTGCAGAATAG GTACCCGGGTACTCCAGGAGA

CTTAAATTCTATTTCAATGGCTTCTTCTCAACTTCACCAGTACAATCCTGATAAATCTCTGACAGATTACGTCACTCGGCTAGAGGCGCTGAGAAGGCGA

CTTGGAGCTATACAGTCAG GGTCCACTACTCAATTTCACTTTGGCATGAGGAGATAATCCGTTGAAACATTAATTGAATATTAAATAGATTCCCTTTTG

TAAATCAATGGCTCTTTTGTGCTTTTGTATTGTGAATATTCGATGGGACCAATACATGCACAGCTTATGATTGTATACAAATCCTTAGCAGCAGCACATG

AAGACAAACTGGAGTTTGTGTATATAAGCAATGTGTGTGTGTTCATGCACAGTAATCATTAAATTACATGTATATTTGTGGAATGCTAATTTAAGTGATT

AAATTATAAACTTTGTGTATTTATCAGGTGGGTGAAAAGATTAAACTTTTTCAAATGACAGTGCTGCTGGACGAGTACCTTGCGGTGCCCTGCGCTTTTC

TTACAAAGCTACTGAAGTTACATGTTTCTGCTTAATATATTTGCTACTGGTGATGAAGACAACATATCACTTGTAGAGACCTATTTTTGTATAATGGTCA

AAGTTTTGAACTTTATGGGTATTTTGTCAAGTACTGAAATAAAAAGACCTCACCATTTTCACCTTA
Translation
MEDEERQRKLAAGKAK - UNI30740 - LARFRQRKAQYDGDIPKKQKKKRTSSSKHDSSLHTDQQSGELCSESSQRVDLAGNPDCSGPERKHGQVFS

AE PESEISTTADECSSE EEEFSLDDSSSEQGAQSSQTCLQMVEKELAEKQHDIEELTQELEEMRASFGTEGLKQ LQEFEAAIKQRDGIITQLTANLQ

QARREKDDTMVEFLELTEQSQKLQIQFQH - UNI35433 - LQANETLQNSTLSRTATDLLQAKRQIFTQQQQLQDYQKKEEDLQAQISFLQEKLRAF

EM EKDRKIENLNAKEIQEKQALIDELNTRVVEEEKKTVELKNKVTTADELLGGLHEQLTQRNQEIQSLKLELGNSQQNERKCSEEIKELMRTVEELQKR

NLKDSWLETSAVRRVEQETQRKLSHLQAELDEMYGKQIVQMKQELINQHMSQIEELKSQHKREMENTLKSDTNAAISKEQVNLMNAAINELNVRLQETHA

QKEELKGELGVVLGEKSALQSQSNDLLEEVRFLREQVQKARQTIAEQENRLSEARKSLSTVEDLKAEIVAASESRKELELKHEAEITNYKIKLEMLEKEK

NAVLDRMAESQEAELERLRTQLLFSHEEELSKLKEDLEVEHRINIEKLKDNLGIHYKQQIDGLQNEMNRKMESMQCETDNLITQQNQLILENSKLRDLQE

CLVNSKSEEMNLQINELQKEIEILKQEEKEKGTLEQEVQELQLKTEQLEKQLKEKEDDLQEKCAQLDAENNILKEEKRVLEDKLKMYSPSEQEERSIAVD

PSTSKSADSRWQKEVAMLRKETEDLQQQCLYLNEEIEKQRNTFAFAEKNFEVNYQELQREYTCLLKIRDDLEATQTKQALEYESKLRALEEELLSKRGNP

AAPKGKSSGIFPSETLEIGEVVEKDTTELMEKLEVTKREKLELSEKVSGLSEQLKQTHCTINSLSAEVRALKQEKEQLLLRCGELELLANPSGTENAAVC

PVQMSSYQAGLVMGKVGDSGGSISKISKDLAEESKPMIEDKIPFKESGREQLLLPTRAQKPSHATVEPCESEKLQQELHALKAEQ DDLRLQMEAQRICL

FVVYSTHADQVRAHMEKEREEALCSLKDELISAQQKKIDELHKMHQCQLQNFKIQETG GDEPLQVLIERLQQAVSEKCFHISK TLNNVFDECYTPLKC

EMNIEEKENSGVYTSQNQSPELQEYRYEVQD DFQESMQVLLGKVTEECRKLSGLQTRLGK IHEQQTDGVALEFAEQNAAEEEAGLLSGCSQSALQSTD

 DVSLESKVSSLPASEKSRECERQVQELQSPVAAGQLQLTETEANHRAETESLQQRLEAVSEAPVQPS - UNI2216 - SLSIDSVVFKGSGAQKPVY

CGSCLRECVDGTAK - UNI2216 - - UNI15225 - FSDRFEVRQETNMVNLMEKQYQERLEEEIAK VIVSMSIAFAQQTELSRLSEGKENTIQS

EQAHTLCSQNKHQLNDITSQSQVGLQTFEATDKNFKEEFKPLSKELGEYRKAVPLSSHDDLDDILKSEEHGLAISEEIFSKDETFIVRKS MHDEVLVSS

MDTSRQLILNEQLEDMRQELVRQYEEHQQATEMLRQAHMQQMERQREDQEQLQEEIKRLNEQLAQ KSSIDTEHVVSERERVLLEELEALKQLPLAGRKE

LCCELRHSSTQTQ DGHDDQEVEEQTLKDKTLERSPEDALLDRNLSNER RYALKKANNRLLKILLEVVKTTSAAEETIGRHVLGILDRSSKGQTASSLL

WRSEADASATTCAPEDCARA AMDESIPSYPGTAIATHDSIWSKVTEEGAELSQRLVRSGFAGPVIDPENEELMLNISSRLQAAVEKLLEAISETNTQ -

 UNI11029 - LEHAKVTQTELMRESFRQKQEATESLHCLEELRERLQEESRAREQLAEELNKAES - UNI11029 - SVIDGYSDEKTLFERQIQE

KTDIIEHLEQEVLCMNNRLQELESDQRRVEEERQLLCRQREAMRAEAGPVEQQ QFLQETEKLMKEKLEVQCQAEKVRGDLQKQVKALEIDVEEQVSRFI

ELEQEKNAELTDLRQQSQALEKQLEKMRKFLD EQAIDREHERDVFQQEIQKLEHQLKAVPRIQPVSEHQARE - UNI7611 - VEQLTNHLKEKTDR

CSELLLSKEQLQRDIQERNEEIEKLECRVRELEQALLASAEPFPK VEDQKRSGAVEADPELSLEVQLQVERDATDRKQKE ITNLEEQLEQFREELENK

NDEVQELLMQLEIQRKESTTRLQELQQENRLFK DEIEKLGFAMKESDSVSTRDQPMLFGKFAQLIQEKEIEIDRLNEQFIKLQQQLKLTTDNK VIEEQ

KEQIQDLETQIERLMSEREHEKKQREEEVEQLTGVVEKLQQEVVSTEQQREGARTLPEDEESFKHQLDKVTAEKLVLEQQVETTNQVMTHMNNVLKEINF

KMDQITQSLCNLNKECASNEELPSLPKESVHMTVHELGSDNLQPEDAPAQDVTKPLEKQTSLTRLQKSPEASRTQEIESLASSVGAKDVELTQCREQTET

IQEQAQSETDRLQKKLTDLQRSLEKFAAALVSQVQMEAAQEYVPFHQEKQPVSSAPGSTDIQNANGLTGASTESLIPTVTLRLAEVESRVAEVHSGTMSE

KLVGIVGGNASETEKRVIELQKLLEEAEERPEEGGEQSSRDGE VRESYMTSLQKDLGQVKDPLTEAKEKLSYSLEKEKRTGEQESREAPIPEPPSVEVG

GCSGLTERTDKVSSSGNQTLQILLRDAAIQTDLQSESSQEEVRDTINQLTKKMEHIQELHAAEILDMESRHILETESLKKEHYVAIQLLTKECETLKEMT

QCLRCKE GSSIPELADSVAYQSREVYSSD DSESDWGQSQGFDTAIEGREEGETSADLFPKKIK GLVKAVHSEGMQVLSLSSPLCDDGEDRSIQQLSE

SWLKERQAYLNTISSLKDLISKMQVRRETE VYDRCHLSDWRGELLLACQRVFIKERSVLLATFQTELTSLSTRDVDGLLNSLEQRIQEQ GIEYHTAMD

CLQKADRRSLLAEIEDLRAQINGGKMTLEREQGTEKSSQE ELLDCSMQQKQSLEMQLELSSLRDRAAELQEQLSSEKMVVAELKSELAQAKLELGTTLK

AQHKRLKELEAFR RSEVKEKTDEIHFLSDTLAREQKNSLELQWALEKEKARSGHHEGREKEELE DLKFSLEDQKRRNTQLNLLLEQQKQLLNESQQKI

ESQKMLHDAQLSEEQGRNLGLQALLESEQVRIQEMKSTLDKERELYAQLQSREDGGQPPPALPSEDLLKELQKQLEEKHSRIVELLSETEKYKLDSLQTR

QQMEKDRQVHQKTLQTEQEANTQGQKKMQELQSKVEELQRQLQEKRQQVYKLDLEGKRLQGLMQEFQKQELEPEEKPGSRGLVDQNLNE PATWNFTDDR

TRNWVLQQKMGEAKDRNFTKLIEINGGELDHNHDLEMIRQTLQHVASKLQHVAQKACSR RLQFETAGDDAFIWIQENIDGIILQLQKLTGQPGDE HSL

GPPSSSCGSLTESLMRQNTELTRLINQLTEEKNTLRSIVIKLEELNRCYWHTGASRDC - UNI32333 - CSRFSFIDPADIEAIIASEKEVWNREKL

SLQKALKRAEAKVYKLKAELRNDALLRNLGPDTDHAALQ KIYNKYLRASSFRKALIYQKKYLLLLLGGFQECEDVTLGVLARMGGHLALKDSKTITNHP

KAFSRFRSAVRVSIAISR RMKFLVRRWQQVTSTSSININRDGFGLSPG GIEKTDPFYHSPGGLQLYGEPRHTMYRSRFDLDYPRSLLPLQNR RYPGT

PGDLNSISMASSQLHQYNPDKSLTDYVTRLEALRRRLGAIQSG GSTTQFHFGMRR

For any suggestions or comments, please send an email to unitrap@crg.es