Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040412 (5330417C22Rik)
Chromosomal location
Chr 3: 108260987 - 108339444 (-)
Description
RIKEN cDNA 5330417C22 gene Gene [Source:MGI Symbol;Acc:MGI:1923930]
RefSeq_dna
NM_001033304 
RefSeq_peptide
NP_001028476.1 
UniGene
Mm.400506 
MGI
MGI:1923930 
Uniprot/SWISSPROT
A2AFS3 
Human Ortholog
ENSG00000116299 (KIAA1324)
Omim not available
UniTrap UNI35896
Vector Insertion
Chr 3: 108294916 - 108339436
Public Clones IST12858E7 (tigm) IST11504E3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34019
Vector Insertion
Chr 3: 108274265 - 108275016
Public Clones IST14723E9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28399
Vector Insertion
Chr 3: 108261387 - 108262602
Public Clones not available
Private Clones OST31948 (lexicon) OST31946 (lexicon) OST28445 (lexicon) OST24070 (lexicon)
Severity of mutation (?) Insertion after 98% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000048012
Sequence
CCTCCTCTGCCAGCATAAGCAGCCACCGCAGCACCTGAGCCGCTACTGCCGCTGGCTCAGGACAGCGCTATGGCAGAGCCTGGTCACAACCCCCATCCTT

CTGCCAGAGACGGAGGAAAAACTGAAAGGCGCACACCCCGGCTTCTGTGGCTGTTGCTTTGGGCTGGGACCACCTTCCAGGTGACCCTGGGAACCGGACC

CGAGCTTCACGCCTGCAAAGAG - UNI35896 - CCTTCTCTTGCAATGCCGGGGAATTTCTGGATATGAAGGACCAGTCCTGCAAGCCCTGCGCGGA

GGGCCGCTACTCCCTCGGCACTGGCATCCGATTTGATGAGTGGGATGAGCTACCTCACGGCTTTGCCAGCCTCTCGGCCAACTTGGAGGTCGATGACAGC

ATCTCGGAGTCCACTGAGAACTGCACTTC GTCCAAGTGGGTTCCCCGGGGAGACTACATCGCCTCCAACACAGATGAATGCACCGCCACACTGATGTAT

GCCGTCAACCTAAAGCAGTCTGGCACCGTTAACTTTGAGTACTACTACCCGGACTCCAGCATCATCTTTGAATTTTTT GTCCAGAATGACCAGTGCCAG

CCCAGTGCTGATGACTCCAGGTGGATGAAGACTACGGAGAAAGGATGGGAATTCCACAGT GTTGAGCTAAATAGAGGCAATAACGTCCTCTATTGGAGA

ACCACAGCTTTCTCGGTGTGGTCCAAAGTGTCCAAGCCCGTGCTTGTTAGAAACATCGCCATAACAG GGGTGGCTTACACCTCCGAGTGTTTCCCCTGC

AAGCCTGGCACATACGCTGCCAAGCAGGGCTCCCCTTTCTGCAAGCTTTGTCCAGCCAACTACTACTCAAACAAAGGAGAAACGTCCTGCCATCCGTGTG

ATGCTGACAAATACTCAG AAAAAGGATCTTCCACCTGCAAAGTGCGCCCAGCCTGCACAGACAAGGACTATTTCTACACCCACACAGCCTGTGATGCTC

AGGGAGAG ACACAGCTCATGTACAAATGGGCCATACCAAAAATCTGCGGTGAGGACCTGGAGGGGGCGGTGAAGCTGCCCGCCTCTGGTGTGAAGACCC

GCTGCCCACCCTGTAACCCGGGCTTCTTCAAAACCGACAACAGCACCTGTGAACCTTGCCCATACGGCTCGTACTCCAACGGCTCGG - UNI34019 -

 ATTGTACCCACTGCCCAGCAGGAACTGAGCCTGCCGTGGGATTTGAGTACAAATGGTGGAACACACTGCCCTCCAACATGGAAACTACGGTTCTCAGTG

GGATCAACTTTGAATACAAGGGCCTGACAG - UNI34019 - GCTGGGAGGTGGCTGGTGACCACATTTATACAGCTGTTGGTGCCTCAGACAACGAC

TTCATGATTCTCACTCTGGTTGTACCAGGATTTAG - UNI34019 - ACCTCCACAGTCAGTGGTGGCAGACACAGAGAACAAAGAGGTGGCCAGGAT

CACATTTGTCTTCGAGACCATCTGCTCTGTGAACTGTGAGCTCTACTTCATGGTG GGCATGAATTCCAGGACCAATACTCCTGTGGAGACGTGGAAGGG

CACCAAAGGCAAGCAGTCCTATACCTACACCATCGAAGAGAATGCTACTGTGAGCTTCACATGGGCCTTCCAGAGGACCACCCTTCATGAAACA GGCAG

GAAGTATACTAATGATGTCGCCAAGATCTACTCAATCAATGTCACCAACGTCATGGGGGGCGTGGCCTCCTACTGCCGTCCCTGTGCCCTAGAAGCCTCT

GATTTGGGCTCCTCCTGCACCTCTTGTCCTGCTGGCCATTACATCAACCGGGATTCTGGGACCTGCCACCTCTGTCCCTCTAACACCATCCTGAAAGCTC

ACCAGCCTTACGGTGCACAGGCCTGTGTGCCCTGTGGTCCAGGGACCAAGAATAACAAG ATCCACTCTCTCTGCTACAACGACTGCACCTTCTCCCGAA

ACACCCCCAGCAGGATTTTCAACTACAACTTCTCAGCTCTGGCAGGCACCGTCTCTCTGGCAGGGGTGCCGAGCTTCACCTCGAAGGGGCTGAAGTATTT

TCATCATTTCACCCTGAGTCTCTGTGGAAACCAG GGGAAAAAAATGGCTGTGTGCACAGACAATGTCACTGACCTCCGGATCCCTGATGGTGAGGCCGG

CTTCTCTAAGTCCGTCACAGCCTATGTCTGCCAGGTTGTCATCATCCCCTCTGAGGTGATGGGCTACAAGGCCGGGGTGTCCTCACAGCCCGTCAGCCTT

GCTGACCGACTTGTTG GAGTGTCAACAGACATGACCTTGGAAGGAATCGTCTCCCCAGTTGAACTTTTTCACCCAGAGACCTCGGGAATTCCGGACATA

GTCTTCTTTTTTAG ATCCAATGATGTGACCCAGTCCTGCAGTTCTGGAAGATCAACCACCATCCGCCTCAGATGCAATCCAATGAAAGCTGCTCCTGGC

ACCCTGCGGCTACCCAG CATGTGCTCTGATGGGACCTGTGATGGCTGTAACTTCCACTTCCTGTGGGAGAGTGTGGCCGCTTGTCCACTCTGCTCGGCC

TCTGACTACCACACTTTTGTCAGCAGCTGTGTGGCTGGGATCCAG AAGACTACTTACATGTGGCGAGAACCAAAGCTGTGCTCTGGGGGCATTTCCCTG

CCTGAGCAGAGAGTTACCATCTGCAAAACGATCGATTTCTGGTTAAAAGTGGGCATCTCGGCTGGCACCTGCACTGCCATCCTGCTTACTGTCCTGACCT

GCTACTTTTGGAAGAAGAATCAAAA ATTAGAATACAAATACTCCAAGTTGGTAATGAACGCTACTCTTAAAGACTGCGACCTGCCGGCAGCAGACAGCT

GTGCCATCATGGAAGGAGAGGACGTGGAGGATGACTTCATCTTTACCAGCAAGAAGTCCCTCTTTGGGAAGATCAAATCCTTTACCTCCAAG - UNI28

399 - AGGACTCCTGATGGATTTGACTCGGTGCCGCTGAAGACGTCTTCAGGAGGCCCAGACATGGACATGTGAGAGGTGCCCGTCCTGCCTCGCCTGC

CTCCTCACCTGGGCACACTACCCTGCAGGCCTGTGGCAGTTTAGGTGCCAGCAACCCTGCGCTCCCCGCTGCTGGGAATCTCTTCATTGTGGCCTTATCA

GAAGTTTGGATTTCAGACCCTTGTTTTTTATAGAGTACCCAAACCTGTCTCTACGCTTGCCTCAAGCCTACCAAATATACCCACACTTCGTGTACTGTTT

CCTTGCTTACATCTTGTTTTCTAAACACAGTCCACCCATGGGAGACTCATCTACCCAGAATTCTTAGCGGTTTTCAGTAAAAGTAGTTTGTTTTTTGTTT

TTTTTT
Translation
 - UNI35896 - MKDQSCKPCAEGRYSLGTGIRFDEWDELPHGFASLSANLEVDDSISESTENCTS SSKWVPRGDYIASNTDECTATLMYAVNLKQS

GTVNFEYYYPDSSIIFEFF VQNDQCQPSADDSRWMKTTEKGWEFHS VELNRGNNVLYWRTTAFSVWSKVSKPVLVRNIAITG GVAYTSECFPCKPGT

YAAKQGSPFCKLCPANYYSNKGETSCHPCDADKYSE EKGSSTCKVRPACTDKDYFYTHTACDAQGE TQLMYKWAIPKICGEDLEGAVKLPASGVKTRC

PPCNPGFFKTDNSTCEPCPYGSYSNGSD - UNI34019 - DCTHCPAGTEPAVGFEYKWWNTLPSNMETTVLSGINFEYKGLTG - UNI34019 - 

GWEVAGDHIYTAVGASDNDFMILTLVVPGFR - UNI34019 - RPPQSVVADTENKEVARITFVFETICSVNCELYFMV GMNSRTNTPVETWKGTKG

KQSYTYTIEENATVSFTWAFQRTTLHET GRKYTNDVAKIYSINVTNVMGGVASYCRPCALEASDLGSSCTSCPAGHYINRDSGTCHLCPSNTILKAHQP

YGAQACVPCGPGTKNNK IHSLCYNDCTFSRNTPSRIFNYNFSALAGTVSLAGVPSFTSKGLKYFHHFTLSLCGNQ GKKMAVCTDNVTDLRIPDGEAGF

SKSVTAYVCQVVIIPSEVMGYKAGVSSQPVSLADRLVG GVSTDMTLEGIVSPVELFHPETSGIPDIVFFFR RSNDVTQSCSSGRSTTIRLRCNPMKAA

PGTLRLPS SMCSDGTCDGCNFHFLWESVAACPLCSASDYHTFVSSCVAGIQ KTTYMWREPKLCSGGISLPEQRVTICKTIDFWLKVGISAGTCTAILL

TVLTCYFWKKNQK KLEYKYSKLVMNATLKDCDLPAADSCAIMEGEDVEDDFIFTSKKSLFGKIKSFTSK - UNI28399 - RTPDGFDSVPLKTSSG

GPDMDM
Transcript ENSMUST00000106625
Sequence
CCTCCTCTGCCAGCATAAGCAGCCACCGCAGCACCTGAGCCGCTACTGCCGCTGGCTCAGGACAGCGCTATGGCAGAGCCTGGTCACAACCCCCATCCTT

CTGCCAGAGACGGAGGAAAAACTGAAAGGCGCACACCCCGGCTTCTGTGGCTGTTGCTTTGGGCTGGGACCACCTTCCAGGTGACCCTGGGAACCGGACC

CGAGCTTCACGCCTGCAAAGAG - UNI35896 - TCAGAGTACCATTTTGAGTACACAGCGTGCGACAGCACAGGTTCCAGGTGGAGGGTCGCCGTGC

CACACAGCCCGGGCTTGTGCACCAGCCTCCCAGACCCCGTCAAGGGCACCGAGTGCT - UNI35896 - CCTTCTCTTGCAATGCCGGGGAATTTCTG

GATATGAAGGACCAGTCCTGCAAGCCCTGCGCGGAGGGCCGCTACTCCCTCGGCACTGGCATCCGATTTGATGAGTGGGATGAGCTACCTCACGGCTTTG

CCAGCCTCTCGGCCAACTTGGAGGTCGATGACAGCATCTCGGAGTCCACTGAGAACTGCACTTC GTCCAAGTGGGTTCCCCGGGGAGACTACATCGCCT

CCAACACAGATGAATGCACCGCCACACTGATGTATGCCGTCAACCTAAAGCAGTCTGGCACCGTTAACTTTGAGTACTACTACCCGGACTCCAGCATCAT

CTTTGAATTTTTT GTCCAGAATGACCAGTGCCAGCCCAGTGCTGATGACTCCAGGTGGATGAAGACTACGGAGAAAGGATGG GTTGAGCTAAATAGAG

GCAATAACGTCCTCTATTGGAGAACCACAGCTTTCTCGGTGTGGTCCAAAGTGTCCAAGCCCGTGCTTGTTAGAAACATCGCCATAACAG GGGTGGCTT

ACACCTCCGAGTGTTTCCCCTGCAAGCCTGGCACATACGCTGCCAAGCAGGGCTCCCCTTTCTGCAAGCTTTGTCCAGCCAACTACTACTCAAACAAAGG

AGAAACGTCCTGCCATCCGTGTGATGCTGACAAATACTCAG AAAAAGGATCTTCCACCTGCAAAGTGCGCCCAGCCTGCACAGACAAGGACTATTTCTA

CACCCACACAGCCTGTGATGCTCAGGGAGAG ACACAGCTCATGTACAAATGGGCCATACCAAAAATCTGCGGTGAGGACCTGGAGGGGGCGGTGAAGCT

GCCCGCCTCTGGTGTGAAGACCCGCTGCCCACCCTGTAACCCGGGCTTCTTCAAAACCGACAACAGCACCTGTGAACCTTGCCCATACGGCTCGTACTCC

AACGGCTCGG - UNI34019 - ATTGTACCCACTGCCCAGCAGGAACTGAGCCTGCCGTGGGATTTGAGTACAAATGGTGGAACACACTGCCCTCCAA

CATGGAAACTACGGTTCTCAGTGGGATCAACTTTGAATACAAGGGCCTGACAG - UNI34019 - GCTGGGAGGTGGCTGGTGACCACATTTATACAG

CTGTTGGTGCCTCAGACAACGACTTCATGATTCTCACTCTGGTTGTACCAGGATTTAG - UNI34019 - ACCTCCACAGTCAGTGGTGGCAGACACA

GAGAACAAAGAGGTGGCCAGGATCACATTTGTCTTCGAGACCATCTGCTCTGTGAACTGTGAGCTCTACTTCATGGTG GGCATGAATTCCAGGACCAAT

ACTCCTGTGGAGACGTGGAAGGGCACCAAAGGCAAGCAGTCCTATACCTACACCATCGAAGAGAATGCTACTGTGAGCTTCACATGGGCCTTCCAGAGGA

CCACCCTTCATGAAACA GGCAGGAAGTATACTAATGATGTCGCCAAGATCTACTCAATCAATGTCACCAACGTCATGGGGGGCGTGGCCTCCTACTGCC

GTCCCTGTGCCCTAGAAGCCTCTGATTTGGGCTCCTCCTGCACCTCTTGTCCTGCTGGCCATTACATCAACCGGGATTCTGGGACCTGCCACCTCTGTCC

CTCTAACACCATCCTGAAAGCTCACCAGCCTTACGGTGCACAGGCCTGTGTGCCCTGTGGTCCAGGGACCAAGAATAACAAG ATCCACTCTCTCTGCTA

CAACGACTGCACCTTCTCCCGAAACACCCCCAGCAGGATTTTCAACTACAACTTCTCAGCTCTGGCAGGCACCGTCTCTCTGGCAGGGGTGCCGAGCTTC

ACCTCGAAGGGGCTGAAGTATTTTCATCATTTCACCCTGAGTCTCTGTGGAAACCAG GGGAAAAAAATGGCTGTGTGCACAGACAATGTCACTGACCTC

CGGATCCCTGATGGTGAGGCCGGCTTCTCTAAGTCCGTCACAGCCTATGTCTGCCAGGTTGTCATCATCCCCTCTGAGGTGATGGGCTACAAGGCCGGGG

TGTCCTCACAGCCCGTCAGCCTTGCTGACCGACTTGTTG GAGTGTCAACAGACATGACCTTGGAAGGAATCGTCTCCCCAGTTGAACTTTTTCACCCAG

AGACCTCGGGAATTCCGGACATAGTCTTCTTTTTTAG ATCCAATGATGTGACCCAGTCCTGCAGTTCTGGAAGATCAACCACCATCCGCCTCAGATGCA

ATCCAATGAAAGCTGCTCCTGGCACCCTGCGGCTACCCAG CATGTGCTCTGATGGGACCTGTGATGGCTGTAACTTCCACTTCCTGTGGGAGAGTGTGG

CCGCTTGTCCACTCTGCTCGGCCTCTGACTACCACACTTTTGTCAGCAGCTGTGTGGCTGGGATCCAG AAGACTACTTACATGTGGCGAGAACCAAAGC

TGTGCTCTGGGGGCATTTCCCTGCCTGAGCAGAGAGTTACCATCTGCAAAACGATCGATTTCTGGTTAAAAGTGGGCATCTCGGCTGGCACCTGCACTGC

CATCCTGCTTACTGTCCTGACCTGCTACTTTTGGAAGAAGAATCAAAA ATTAGAATACAAATACTCCAAGTTGGTAATGAACGCTACTCTTAAAGACTG

CGACCTGCCGGCAGCAGACAGCTGTGCCATCATGGAAGGAGAGGACGTGGAGGATGACTTCATCTTTACCAGCAAGAAGTCCCTCTTTGGGAAGATCAAA

TCCTTTACCTCCAAG - UNI28399 - AGGACTCCTGATGGATTTGACTCGGTGCCGCTGAAGACGTCTTCAGGAGGCCCAGACATGGACATGTGAGA

GGTGCCCGTCCTGCCTCGCCTGCCTCCTCACCTGGGCACACTACCCTGCAGGCCTGTGGCAGTTTAGGTGCCAGCAACCCTGCGCTCCCCGCTGCTGGGA

ATCTCTTCATTGTGGCCTTATCAGAAGTTTGGATTTCAGACCCTTGTTTTTTATAGAGTACCCAAACCTGTCTCTACGCTTGCCTCAAGCCTACCAAATA

TACCCACACTTCGTGTACTGTTTCCTTGCTTACATCTTGTTTTCTAAACACAGTCCACCCATGGGAGACTCATCTACCCAGAATTCTTAGCGGTTTTCAG

TAAAAGTAGTTTGTTTTTTGTTTTTTTTT
Translation
MAEPGHNPHPSARDGGKTERRTPRLLWLLLWAGTTFQVTLGTGPELHACKE - UNI35896 - SEYHFEYTACDSTGSRWRVAVPHSPGLCTSLPDPV

KGTECS - UNI35896 - SFSCNAGEFLDMKDQSCKPCAEGRYSLGTGIRFDEWDELPHGFASLSANLEVDDSISESTENCTS SSKWVPRGDYIASN

TDECTATLMYAVNLKQSGTVNFEYYYPDSSIIFEFF VQNDQCQPSADDSRWMKTTEKGW VELNRGNNVLYWRTTAFSVWSKVSKPVLVRNIAITG GV

AYTSECFPCKPGTYAAKQGSPFCKLCPANYYSNKGETSCHPCDADKYSE EKGSSTCKVRPACTDKDYFYTHTACDAQGE TQLMYKWAIPKICGEDLEG

AVKLPASGVKTRCPPCNPGFFKTDNSTCEPCPYGSYSNGSD - UNI34019 - DCTHCPAGTEPAVGFEYKWWNTLPSNMETTVLSGINFEYKGLTG 

- UNI34019 - GWEVAGDHIYTAVGASDNDFMILTLVVPGFR - UNI34019 - RPPQSVVADTENKEVARITFVFETICSVNCELYFMV GMNSR

TNTPVETWKGTKGKQSYTYTIEENATVSFTWAFQRTTLHET GRKYTNDVAKIYSINVTNVMGGVASYCRPCALEASDLGSSCTSCPAGHYINRDSGTCH

LCPSNTILKAHQPYGAQACVPCGPGTKNNK IHSLCYNDCTFSRNTPSRIFNYNFSALAGTVSLAGVPSFTSKGLKYFHHFTLSLCGNQ GKKMAVCTDN

VTDLRIPDGEAGFSKSVTAYVCQVVIIPSEVMGYKAGVSSQPVSLADRLVG GVSTDMTLEGIVSPVELFHPETSGIPDIVFFFR RSNDVTQSCSSGRS

TTIRLRCNPMKAAPGTLRLPS SMCSDGTCDGCNFHFLWESVAACPLCSASDYHTFVSSCVAGIQ KTTYMWREPKLCSGGISLPEQRVTICKTIDFWLK

VGISAGTCTAILLTVLTCYFWKKNQK KLEYKYSKLVMNATLKDCDLPAADSCAIMEGEDVEDDFIFTSKKSLFGKIKSFTSK - UNI28399 - RTP

DGFDSVPLKTSSGGPDMDM
Transcript ENSMUST00000106626
Sequence
TTTTTTTTTCCTCCTCTGCCAGCATAAGCAGCCACCGCAGCACCTGAGCCGCTACTGCCGCTGGCTCAGGACAGCGCTATGGCAGAGCCTGGTCACAACC

CCCATCCTTCTGCCAGAGACGGAGGAAAAACTGAAAGGCGCACACCCCGGCTTCTGTGGCTGTTGCTTTGGGCTGGGACCACCTTCCAGGTGACCCTGGG

AACCGGACCCGAGCTTCACGCCTGCAAAGAG - UNI35896 - TCAGAGTACCATTTTGAGTACACAGCGTGCGACAGCACAGGTTCCAGGTGGAGGG

TCGCCGTGCCACACAGCCCGGGCTTGTGCACCAGCCTCCCAGACCCCGTCAAGGGCACCGAGTGCT - UNI35896 - CCTTCTCTTGCAATGCCGGG

GAATTTCTGGATATGAAGGACCAGTCCTGCAAGCCCTGCGCGGAGGGCCGCTACTCCCTCGGCACTGGCATCCGATTTGATGAGTGGGATGAGCTACCTC

ACGGCTTTGCCAGCCTCTCGGCCAACTTGGAGGTCGATGACAGCATCTCGGAGTCCACTGAGAACTGCACTTC GTCCAAGTGGGTTCCCCGGGGAGACT

ACATCGCCTCCAACACAGATGAATGCACCGCCACACTGATGTATGCCGTCAACCTAAAGCAGTCTGGCACCGTTAACTTTGAGTACTACTACCCGGACTC

CAGCATCATCTTTGAATTTTTT GTCCAGAATGACCAGTGCCAGCCCAGTGCTGATGACTCCAGGTGGATGAAGACTACGGAGAAAGGATGG GTTGAGC

TAAATAGAGGCAATAACGTCCTCTATTGGAGAACCACAGCTTTCTCGGTGTGGTCCAAAGTGTCCAAGCCCGTGCTTGTTAGAAACATCGCCATAACAG 

AAAAAGGATCTTCCACCTGCAAAGTGCGCCCAGCCTGCACAGACAAGGACTATTTCTACACCCACACAGCCTGTGATGCTCAGGGAGAG ACACAGCTCA

TGTACAAATGGGCCATACCAAAAATCTGCGGTGAGGACCTGGAGGGGGCGGTGAAGCTGCCCGCCTCTGGTGTGAAGACCCGCTGCCCACCCTGTAACCC

GGGCTTCTTCAAAACCGACAACAGCACCTGTGAACCTTGCCCATACGGCTCGTACTCCAACGGCTCGG - UNI34019 - ATTGTACCCACTGCCCAG

CAGGAACTGAGCCTGCCGTGGGATTTGAGTACAAATGGTGGAACACACTGCCCTCCAACATGGAAACTACGGTTCTCAGTGGGATCAACTTTGAATACAA

GGGCCTGACAG - UNI34019 - GCTGGGAGGTGGCTGGTGACCACATTTATACAGCTGTTGGTGCCTCAGACAACGACTTCATGATTCTCACTCTGG

TTGTACCAGGATTTAG - UNI34019 - ACCTCCACAGTCAGTGGTGGCAGACACAGAGAACAAAGAGGTGGCCAGGATCACATTTGTCTTCGAGACC

ATCTGCTCTGTGAACTGTGAGCTCTACTTCATGGTG GGCATGAATTCCAGGACCAATACTCCTGTGGAGACGTGGAAGGGCACCAAAGGCAAGCAGTCC

TATACCTACACCATCGAAGAGAATGCTACTGTGAGCTTCACATGGGCCTTCCAGAGGACCACCCTTCATGAAACA GGCAGGAAGTATACTAATGATGTC

GCCAAGATCTACTCAATCAATGTCACCAACGTCATGGGGGGCGTGGCCTCCTACTGCCGTCCCTGTGCCCTAGAAGCCTCTGATTTGGGCTCCTCCTGCA

CCTCTTGTCCTGCTGGCCATTACATCAACCGGGATTCTGGGACCTGCCACCTCTGTCCCTCTAACACCATCCTGAAAGCTCACCAGCCTTACGGTGCACA

GGCCTGTGTGCCCTGTGGTCCAGGGACCAAGAATAACAAG ATCCACTCTCTCTGCTACAACGACTGCACCTTCTCCCGAAACACCCCCAGCAGGATTTT

CAACTACAACTTCTCAGCTCTGGCAGGCACCGTCTCTCTGGCAGGGGTGCCGAGCTTCACCTCGAAGGGGCTGAAGTATTTTCATCATTTCACCCTGAGT

CTCTGTGGAAACCAG GGGAAAAAAATGGCTGTGTGCACAGACAATGTCACTGACCTCCGGATCCCTGATGGTGAGGCCGGCTTCTCTAAGTCCGTCACA

GCCTATGTCTGCCAGGTTGTCATCATCCCCTCTGAGGTGATGGGCTACAAGGCCGGGGTGTCCTCACAGCCCGTCAGCCTTGCTGACCGACTTGTTG GA

GTGTCAACAGACATGACCTTGGAAGGAATCGTCTCCCCAGTTGAACTTTTTCACCCAGAGACCTCGGGAATTCCGGACATAGTCTTCTTTTTTAG ATCC

AATGATGTGACCCAGTCCTGCAGTTCTGGAAGATCAACCACCATCCGCCTCAGATGCAATCCAATGAAAGCTGCTCCTGGCACCCTGCGGCTACCCAG C

ATGTGCTCTGATGGGACCTGTGATGGCTGTAACTTCCACTTCCTGTGGGAGAGTGTGGCCGCTTGTCCACTCTGCTCGGCCTCTGACTACCACACTTTTG

TCAGCAGCTGTGTGGCTGGGATCCAG AAGACTACTTACATGTGGCGAGAACCAAAGCTGTGCTCTGGGGGCATTTCCCTGCCTGAGCAGAGAGTTACCA

TCTGCAAAACGATCGATTTCTGGTTAAAAGTGGGCATCTCGGCTGGCACCTGCACTGCCATCCTGCTTACTGTCCTGACCTGCTACTTTTGGAAGAAGAA

TCAAAA ATTAGAATACAAATACTCCAAGTTGGTAATGAACGCTACTCTTAAAG - UNI28399 - TTGTGGCCTTATCAGAAGTTTGGATTTCAGAC

CCTTGTTTTTTATAGAGTACCCAAACCTGTCTCTACGCTTGCCTCAAGCCTACCAAATATACCCACACTTCGT
Translation
MAEPGHNPHPSARDGGKTERRTPRLLWLLLWAGTTFQVTLGTGPELHACKE - UNI35896 - SEYHFEYTACDSTGSRWRVAVPHSPGLCTSLPDPV

KGTECS - UNI35896 - SFSCNAGEFLDMKDQSCKPCAEGRYSLGTGIRFDEWDELPHGFASLSANLEVDDSISESTENCTS SSKWVPRGDYIASN

TDECTATLMYAVNLKQSGTVNFEYYYPDSSIIFEFF VQNDQCQPSADDSRWMKTTEKGW VELNRGNNVLYWRTTAFSVWSKVSKPVLVRNIAITE EK

GSSTCKVRPACTDKDYFYTHTACDAQGE TQLMYKWAIPKICGEDLEGAVKLPASGVKTRCPPCNPGFFKTDNSTCEPCPYGSYSNGSD - UNI34019

 - DCTHCPAGTEPAVGFEYKWWNTLPSNMETTVLSGINFEYKGLTG - UNI34019 - GWEVAGDHIYTAVGASDNDFMILTLVVPGFR - UNI34

019 - RPPQSVVADTENKEVARITFVFETICSVNCELYFMV GMNSRTNTPVETWKGTKGKQSYTYTIEENATVSFTWAFQRTTLHET GRKYTNDVAK

IYSINVTNVMGGVASYCRPCALEASDLGSSCTSCPAGHYINRDSGTCHLCPSNTILKAHQPYGAQACVPCGPGTKNNK IHSLCYNDCTFSRNTPSRIFN

YNFSALAGTVSLAGVPSFTSKGLKYFHHFTLSLCGNQ GKKMAVCTDNVTDLRIPDGEAGFSKSVTAYVCQVVIIPSEVMGYKAGVSSQPVSLADRLVG 

GVSTDMTLEGIVSPVELFHPETSGIPDIVFFFR RSNDVTQSCSSGRSTTIRLRCNPMKAAPGTLRLPS SMCSDGTCDGCNFHFLWESVAACPLCSASD

YHTFVSSCVAGIQ KTTYMWREPKLCSGGISLPEQRVTICKTIDFWLKVGISAGTCTAILLTVLTCYFWKKNQK KLEYKYSKLVMNATLKV - UNI28

399 - VVALSEVWISDPCFL
Transcript ENSMUST00000106627
Sequence
CCTCCTCTGCCAGCATAAGCAGCCACCGCAGCACCTGAGCCGCTACTGCCGCTGGCTCAGGACAGCGCTATGGCAGAGCCTGGTCACAACCCCCATCCTT

CTGCCAGAGACGGAGGAAAAACTGAAAGGCGCACACCCCGGCTTCTGTGGCTGTTGCTTTGGGCTGGGACCACCTTCCAGGTGACCCTGGGAACCGGACC

CGAGCTTCACGCCTGCAAAGAG - UNI35896 - TCAGAGTACCATTTTGAGTACACAGCGTGCGACAGCACAGGTTCCAGGTGGAGGGTCGCCGTGC

CACACAGCCCGGGCTTGTGCACCAGCCTCCCAGACCCCGTCAAGGGCACCGAGTGCT - UNI35896 - CCTTCTCTTGCAATGCCGGGGAATTTCTG

GATATGAAGGACCAGTCCTGCAAGCCCTGCGCGGAGGGCCGCTACTCCCTCGGCACTGGCATCCGATTTGATGAGTGGGATGAGCTACCTCACGGCTTTG

CCAGCCTCTCGGCCAACTTGGAGGTCGATGACAGCATCTCGGAGTCCACTGAGAACTGCACTTC GTCCAAGTGGGTTCCCCGGGGAGACTACATCGCCT

CCAACACAGATGAATGCACCGCCACACTGATGTATGCCGTCAACCTAAAGCAGTCTGGCACCGTTAACTTTGAGTACTACTACCCGGACTCCAGCATCAT

CTTTGAATTTTTT GTCCAGAATGACCAGTGCCAGCCCAGTGCTGATGACTCCAGGTGGATGAAGACTACGGAGAAAGGATGG GTTGAGCTAAATAGAG

GCAATAACGTCCTCTATTGGAGAACCACAGCTTTCTCGGTGTGGTCCAAAGTGTCCAAGCCCGTGCTTGTTAGAAACATCGCCATAACAG AAAAAGGAT

CTTCCACCTGCAAAGTGCGCCCAGCCTGCACAGACAAGGACTATTTCTACACCCACACAGCCTGTGATGCTCAGGGAGAG ACACAGCTCATGTACAAAT

GGGCCATACCAAAAATCTGCGGTGAGGACCTGGAGGGGGCGGTGAAGCTGCCCGCCTCTGGTGTGAAGACCCGCTGCCCACCCTGTAACCCGGGCTTCTT

CAAAACCGACAACAGCACCTGTGAACCTTGCCCATACGGCTCGTACTCCAACGGCTCGG - UNI34019 - ATTGTACCCACTGCCCAGCAGGAACTG

AGCCTGCCGTGGGATTTGAGTACAAATGGTGGAACACACTGCCCTCCAACATGGAAACTACGGTTCTCAGTGGGATCAACTTTGAATACAAGGGCCTGAC

AG - UNI34019 - GCTGGGAGGTGGCTGGTGACCACATTTATACAGCTGTTGGTGCCTCAGACAACGACTTCATGATTCTCACTCTGGTTGTACCAG

GATTTAG - UNI34019 - ACCTCCACAGTCAGTGGTGGCAGACACAGAGAACAAAGAGGTGGCCAGGATCACATTTGTCTTCGAGACCATCTGCTCT

GTGAACTGTGAGCTCTACTTCATGGTG GGCATGAATTCCAGGACCAATACTCCTGTGGAGACGTGGAAGGGCACCAAAGGCAAGCAGTCCTATACCTAC

ACCATCGAAGAGAATGCTACTGTGAGCTTCACATGGGCCTTCCAGAGGACCACCCTTCATGAAACA GGCAGGAAGTATACTAATGATGTCGCCAAGATC

TACTCAATCAATGTCACCAACGTCATGGGGGGCGTGGCCTCCTACTGCCGTCCCTGTGCCCTAGAAGCCTCTGATTTGGGCTCCTCCTGCACCTCTTGTC

CTGCTGGCCATTACATCAACCGGGATTCTGGGACCTGCCACCTCTGTCCCTCTAACACCATCCTGAAAGCTCACCAGCCTTACGGTGCACAGGCCTGTGT

GCCCTGTGGTCCAGGGACCAAGAATAACAAG ATCCACTCTCTCTGCTACAACGACTGCACCTTCTCCCGAAACACCCCCAGCAGGATTTTCAACTACAA

CTTCTCAGCTCTGGCAGGCACCGTCTCTCTGGCAGGGGTGCCGAGCTTCACCTCGAAGGGGCTGAAGTATTTTCATCATTTCACCCTGAGTCTCTGTGGA

AACCAG GGGAAAAAAATGGCTGTGTGCACAGACAATGTCACTGACCTCCGGATCCCTGATGGTGAGGCCGGCTTCTCTAAGTCCGTCACAGCCTATGTC

TGCCAGGTTGTCATCATCCCCTCTGAGGTGATGGGCTACAAGGCCGGGGTGTCCTCACAGCCCGTCAGCCTTGCTGACCGACTTGTTG GAGTGTCAACA

GACATGACCTTGGAAGGAATCGTCTCCCCAGTTGAACTTTTTCACCCAGAGACCTCGGGAATTCCGGACATAGTCTTCTTTTTTAG ATCCAATGATGTG

ACCCAGTCCTGCAGTTCTGGAAGATCAACCACCATCCGCCTCAGATGCAATCCAATGAAAGCTGCTCCTGGCACCCTGCGGCTACCCAG CATGTGCTCT

GATGGGACCTGTGATGGCTGTAACTTCCACTTCCTGTGGGAGAGTGTGGCCGCTTGTCCACTCTGCTCGGCCTCTGACTACCACACTTTTGTCAGCAGCT

GTGTGGCTGGGATCCAG AAGACTACTTACATGTGGCGAGAACCAAAGCTGTGCTCTGGGGGCATTTCCCTGCCTGAGCAGAGAGTTACCATCTGCAAAA

CGATCGATTTCTGGTTAAAAGTGGGCATCTCGGCTGGCACCTGCACTGCCATCCTGCTTACTGTCCTGACCTGCTACTTTTGGAAGAAGAATCAAAA AT

TAGAATACAAATACTCCAAGTTGGTAATGAACGCTACTCTTAAAGA - UNI28399 - TGTGGCCTTATCAGAAGTTTGGATTTCAGACCCTTGTTTT

TTATAG
Translation
MAEPGHNPHPSARDGGKTERRTPRLLWLLLWAGTTFQVTLGTGPELHACKE - UNI35896 - SEYHFEYTACDSTGSRWRVAVPHSPGLCTSLPDPV

KGTECS - UNI35896 - SFSCNAGEFLDMKDQSCKPCAEGRYSLGTGIRFDEWDELPHGFASLSANLEVDDSISESTENCTS SSKWVPRGDYIASN

TDECTATLMYAVNLKQSGTVNFEYYYPDSSIIFEFF VQNDQCQPSADDSRWMKTTEKGW VELNRGNNVLYWRTTAFSVWSKVSKPVLVRNIAITE EK

GSSTCKVRPACTDKDYFYTHTACDAQGE TQLMYKWAIPKICGEDLEGAVKLPASGVKTRCPPCNPGFFKTDNSTCEPCPYGSYSNGSD - UNI34019

 - DCTHCPAGTEPAVGFEYKWWNTLPSNMETTVLSGINFEYKGLTG - UNI34019 - GWEVAGDHIYTAVGASDNDFMILTLVVPGFR - UNI34

019 - RPPQSVVADTENKEVARITFVFETICSVNCELYFMV GMNSRTNTPVETWKGTKGKQSYTYTIEENATVSFTWAFQRTTLHET GRKYTNDVAK

IYSINVTNVMGGVASYCRPCALEASDLGSSCTSCPAGHYINRDSGTCHLCPSNTILKAHQPYGAQACVPCGPGTKNNK IHSLCYNDCTFSRNTPSRIFN

YNFSALAGTVSLAGVPSFTSKGLKYFHHFTLSLCGNQ GKKMAVCTDNVTDLRIPDGEAGFSKSVTAYVCQVVIIPSEVMGYKAGVSSQPVSLADRLVG 

GVSTDMTLEGIVSPVELFHPETSGIPDIVFFFR RSNDVTQSCSSGRSTTIRLRCNPMKAAPGTLRLPS SMCSDGTCDGCNFHFLWESVAACPLCSASD

YHTFVSSCVAGIQ KTTYMWREPKLCSGGISLPEQRVTICKTIDFWLKVGISAGTCTAILLTVLTCYFWKKNQK KLEYKYSKLVMNATLKD - UNI28

399 - DVALSEVWISDPCFL

For any suggestions or comments, please send an email to unitrap@crg.es