Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040424 (Hipk4)
Chromosomal location
Chr 7: 28308536 - 28316191 (+)
Description
homeodomain interacting protein kinase 4 Gene [Source:MGI (curated);Acc:Hipk4-001]
RefSeq_dna
NM_001033315 
RefSeq_peptide
NP_001028487.2 
UniGene
Mm.429716 
MGI
MGI:2685008 
Uniprot/SWISSPROT
Q3V016 
Human Ortholog
ENSG00000160396 (HIPK4)
Omim not available
UniTrap UNI28976
Vector Insertion
Chr 7: 28313314 - 28313672
Public Clones not available
Private Clones OST14486 (lexicon)
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13367
Vector Insertion
Chr 7: 28314817 - 28315706
Public Clones CMHD-GT_316B4-3 (cmhd)
Private Clones OST6704 (lexicon)
Severity of mutation (?) Insertion after 90% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000037134
Sequence
ACACACACATACATATACATACATATATATATGAGAAGGGAGCCAGACCTGGTGAAACATGCCTATAATCCCAGATTATTGTACCTTCTACATTTCCTCT

CTTATGAATGACCCTGCCTGAAGTTCAATCTCTAGGACCATGGAAGACAGACACACAAATCAAAGGGAGGACAATACTGATTGGTGTAAAATGCCTACTA

GTTCCAGGCCTCCAGAGACACAGCCTTGAATAAAATACAAAGCTCTTGTTGTCATGGGACTGGAGTTCTATTTTTTTTTTCATTTATTTTCTTTTTATAT

GTGAGTGCAAATGTATGGATGTATGGTGTTCCAAGAGGTCAGAGGGCTTTGGATTCCCCCTGGAACTAGAGTTCCAGACAGGTGTGAGCTGCCATGTGGG

TGCTGGGAGCCAAACCTGGATTCCCTGCAAGAGCAGCCAGTGCTCTTTACCACTGAGCCATCTCTCAGGCCTAGCGGGTTAAGTGCTTGCTGCACACAAG

CAGAAGAGCCTAAATTCAGATCCCCAGGGACCCCATAAAAGCTGGGCTTGACTTTATAATCCCAGGGCTGAGGGGATGTAAGGGAAGACAAGAAGATCCT

GAGGGCTCAGTGGCCCGGCTATCTTGCCAAAGTTGTGAGTTTCAGGTTCACTAAGAGACCTTGCCTCACAAAATAAGGTTACAGCGGTAGAGGAAGATAG

AGGACCTTTGGCCTTATACATGCACACATGGGTGATGACACCCACATATGCCTATAACACCTCCAACACACACAACACCCCCCCTCAGGGAAATATATAT

ATAGTATGTGAAATGATGTTAAAATCATAGCTGGGAGCTGGGTGAAAGAACAGGAATTCAAGGACATCCTTGGCTACATAACCAGGTTGAAGCCAGCCTG

GGCTATATGAGACCCTGTCTCAAAACTAACCAACAAAAAGGACAGAGGATATGGGTGAATACTTGCCTACTATGCACTACAGCAGGGGGAGGGTCCCAAC

TATTATAGGCACAAGTTCAAGCAGAGAATCAGACAGAGCCAGACCTGACACCTGACACAGAAGCAATAGCTAGAGGACAGAGGCAGGGTCATTCATAAGA

AAGGAAGTGTAGAAGGTACAAGAGCTAGGCAGACACAGGAGATACACAGGGATGAGTCCCAGGAGGGGCCTATCCTGTCATCTCTACCACTCCACCAACC

CAGCTGCCCTGTGCTCCATCCCCTCTGTCCTCCATAGGTGATCGACTTTGGCTCGGCCAGCATATTCAGTGAGGTACGCTATGTGAAGGAGCCTTACATC

CAGTCCCGCTTCTACAGGGCCCCAGAGATCCTGCTGGGGCTGCCCTTCTGTGAGAAGGTGGACGTGTGGTCTCTGGGCTGTGTCATGGCCGAGCTACATC

TGGGCTGGCCTCTCTACCCAGGCAACAATGAGTATGACCAGGTGCGCTACATCTGTGAGACCCAGGGCTTACCCAAGCCCCATTTGCTGCATGCGGCTCG

CAAGGCTCACCACTTCTTCAAGCGTAACCCCCACCCCGATGCCACCAACCCCTGGCAGCTGAAGTCCTCTGCTGACTACCTAGCTGAGACCAAG - UNI

28976 - GTACGTCCTCTGGAGCGCCGCAAGTACATGCTCAAATCCTTGGACCAGATTGAGACAGTGAATGGTGGTGGAGCTGTGAGCCGGCTGAGTTT

TCCAGACCGGGAGGCCCTGGCGGAACACGCAGACCTCAAGAGCATGGTGGAGCTGATCAAACGCATGCTGACATGGGAGTCGCACGAACGCATCAGTCCC

AGTGCGGCCCTGCGTCACCCCTTCGTGTCCATGCAGCAGCTGCGGAGTGCCCACGAGGCCACCCGCTACTACCAGCTGTCGCTCAGAGGCTGTCGGCTGT

CCCTGCAGGTGGATGGCAAGCCACCCCCACCTGTCATAGCCAGCGCAGAGGACGGGCCTCCCTACTACCGCCTGGCTGAGGAGGAGGAGACTGCAGGCCT

GGGTGGTGTGACAGGCAGTGGGTCCTTCTTCAGGGAGGACAAGGCTCCGGGAATGCAGAGGGCCATCGACCAGCTCGATGACCTGAGTCTGCAAGAGGCC

AGACGGGGGCTGTGGAGCGACACACGGGCCGACATGGTCTCTGACATGCTGGTTCCACTCAAAGTGGCCAGTACCAGCCACCGAGTCCCTGACTCAGGCC

CAGAGCCTATCCTGGCCTTCTACGGCAGCCGATTGACCGGCCGCCATAAGGCCCGCAAGGCCCCAGCAGGCTCCAAATCTGACTCCAACTTCAGTAACCT

CATTCGGCTGAGCCAGGCCTCACCTGAGGATGCCGGGCCCTGTCGGGGCAGTGGCTGGGAGGAAGGAGAAGGCCGCACGACCTCCACAGAGCCGTCTGTC

ATCCCACAACGGGAAGGAGATGGGCCTGGCATCAAAGACAGGCCCATGGATGCCGAG - UNI13367 - AGGCCAGGCCCTGAGCTCTTTGATCCCAG

CAGCTGTCCTGGAGAGTGGCTGAGTGAGCCAGAATGGACCCTAGAGGGCATCCGGGGGTCTCGAGCTCAAGGGCTCCCAGCTCACCATCCCCACCCCCAC

GGGCCACCCAGGACCACCAGCTTTCTGCAGCATGTTGGAGGGCACCACTGATGGGGACTCACCCCTATCGTTTCATGGGGTCTGAGCTAGCTGGGCTGGC

GTTCCCCTTCTTGATCCGAAATGGCACCTTAGAGCCATCCTCTGAACCTACAGATTATTCTTACAGAAAAATAGAAATCCAGATGTTCCTATTCCCCTGC

CCCTGGCACATGCCTGTATCCCACCCTAAATGTTGGAGGTCGTCAGGGTCTGGCCTGAGGCCCTGAGGCCAGTGAGTTGGGAAGAGGCTGCACCCTGGTG

GCCATGACTGTGCCTGGGCCTGCCTGCCTCTGTGTATTTCAATAAATAACTGTTCC
Translation
MAELHLGWPLYPGNNEYDQVRYICETQGLPKPHLLHAARKAHHFFKRNPHPDATNPWQLKSSADYLAETK - UNI28976 - VRPLERRKYMLKSLDQ

IETVNGGGAVSRLSFPDREALAEHADLKSMVELIKRMLTWESHERISPSAALRHPFVSMQQLRSAHEATRYYQLSLRGCRLSLQVDGKPPPPVIASAEDG

PPYYRLAEEEETAGLGGVTGSGSFFREDKAPGMQRAIDQLDDLSLQEARRGLWSDTRADMVSDMLVPLKVASTSHRVPDSGPEPILAFYGSRLTGRHKAR

KAPAGSKSDSNFSNLIRLSQASPEDAGPCRGSGWEEGEGRTTSTEPSVIPQREGDGPGIKDRPMDAE - UNI13367 - RPGPELFDPSSCPGEWLSE

PEWTLEGIRGSRAQGLPAHHPHPHGPPRTTSFLQHVGGHH
Transcript ENSMUST00000108353
Sequence
ATGGCCACCATCCAGTCAGAGACTGACTGCTACGACATCATTGAAGTTCTGGGCAAGGGCACTTTTGGAGAGGTGGCCAAGGGCTGGCGTCGGAGTACAG

GTGAAATGGTGGCCATCAAGATCCTGAAGAACGATGCGTACCGAAGCCGCATCATCAAGAATGAGCTGAAGCTGCTGCGCTGCGTGCGAGGCCTGGACCC

TGACGAGGCCCACGTTATCCGCTTCCTTGAGTTCTTCCACGATGCCCTCAAGTTCTACCTGGTCTTCGAGCTTTTGGAGCAAAACCTCTTTGAGTTCCAG

AAAGAGAACAACTTCGCACCCCTTCCTGCCAGGCACATCCGCACGGTCACACTGCAGGTACTAAGAGCGCTGGCCCGGCTCAAGGAACTGGCCATCATCC

ACGCTGACCTCAAGCCTGAAAACATTATGTTGGTAGACCAGACGCGCTGCCCCTTCAGGGTCAAG - UNI28976 - GTGATCGACTTTGGCTCGGCC

AGCATATTCAGTGAGGTACGCTATGTGAAGGAGCCTTACATCCAGTCCCGCTTCTACAGGGCCCCAGAGATCCTGCTGGGGCTGCCCTTCTGTGAGAAGG

TGGACGTGTGGTCTCTGGGCTGTGTCATGGCCGAGCTACATCTGGGCTGGCCTCTCTACCCAGGCAACAATGAGTATGACCAGGTGCGCTACATCTGTGA

GACCCAGGGCTTACCCAAGCCCCATTTGCTGCATGCGGCTCGCAAGGCTCACCACTTCTTCAAGCGTAACCCCCACCCCGATGCCACCAACCCCTGGCAG

CTGAAGTCCTCTGCTGACTACCTAGCTGAGACCAAG - UNI28976 - GTACGTCCTCTGGAGCGCCGCAAGTACATGCTCAAATCCTTGGACCAGAT

TGAGACAGTGAATGGTGGTGGAGCTGTGAGCCGGCTGAGTTTTCCAGACCGGGAGGCCCTGGCGGAACACGCAGACCTCAAGAGCATGGTGGAGCTGATC

AAACGCATGCTGACATGGGAGTCGCACGAACGCATCAGTCCCAGTGCGGCCCTGCGTCACCCCTTCGTGTCCATGCAGCAGCTGCGGAGTGCCCACGAGG

CCACCCGCTACTACCAGCTGTCGCTCAGAGGCTGTCGGCTGTCCCTGCAGGTGGATGGCAAGCCACCCCCACCTGTCATAGCCAGCGCAGAGGACGGGCC

TCCCTACTACCGCCTGGCTGAGGAGGAGGAGACTGCAGGCCTGGGTGGTGTGACAGGCAGTGGGTCCTTCTTCAGGGAGGACAAGGCTCCGGGAATGCAG

AGGGCCATCGACCAGCTCGATGACCTGAGTCTGCAAGAGGCCAGACGGGGGCTGTGGAGCGACACACGGGCCGACATGGTCTCTGACATGCTGGTTCCAC

TCAAAGTGGCCAGTACCAGCCACCGAGTCCCTGACTCAGGCCCAGAGCCTATCCTGGCCTTCTACGGCAGCCGATTGACCGGCCGCCATAAGGCCCGCAA

GGCCCCAGCAGGCTCCAAATCTGACTCCAACTTCAGTAACCTCATTCGGCTGAGCCAGGCCTCACCTGAGGATGCCGGGCCCTGTCGGGGCAGTGGCTGG

GAGGAAGGAGAAGGCCGCACGACCTCCACAGAGCCGTCTGTCATCCCACAACGGGAAGGAGATGGGCCTGGCATCAAAGACAGGCCCATGGATGCCGAG 

- UNI13367 - AGGCCAGGCCCTGAGCTCTTTGATCCCAGCAGCTGTCCTGGAGAGTGGCTGAGTGAGCCAGAATGGACCCTAGAGGGCATCCGGGGG

TCTCGAGCTCAAGGGCTCCCAGCTCACCATCCCCACCCCCACGGGCCACCCAGGACCACCAGCTTTCTGCAGCATGTTGGAGGGCACCACTGATGGGGAC

TCACCCCTATCGTTTCATGGGGTCTGAGCTAGCTGGGCTGGCGTTCCCCTTCTTGATCCGAAATGGCACCTTAGAGCCATCCTCTGAACCTACAGATTAT

TCTTACAGAAAAATAGAAATCCAGATGTTCCTATTCCCCTGCCCCTGGCACATGCCTGTATCCCACCCTAAATGTTGGAGGTCGTCAGGGTCTGGCCTGA

GGCCCTGAGGCCAGTGAGTTGGGAAGAGGCTGCACCCTGGTGGCCATGACTGTGCCTGGGCCTGCCTGCCTCTGTGTATTTCAATAAATAACTGTTCC
Translation
MATIQSETDCYDIIEVLGKGTFGEVAKGWRRSTGEMVAIKILKNDAYRSRIIKNELKLLRCVRGLDPDEAHVIRFLEFFHDALKFYLVFELLEQNLFEFQ

KENNFAPLPARHIRTVTLQVLRALARLKELAIIHADLKPENIMLVDQTRCPFRVK - UNI28976 - VIDFGSASIFSEVRYVKEPYIQSRFYRAPEI

LLGLPFCEKVDVWSLGCVMAELHLGWPLYPGNNEYDQVRYICETQGLPKPHLLHAARKAHHFFKRNPHPDATNPWQLKSSADYLAETK - UNI28976 

- VRPLERRKYMLKSLDQIETVNGGGAVSRLSFPDREALAEHADLKSMVELIKRMLTWESHERISPSAALRHPFVSMQQLRSAHEATRYYQLSLRGCRLS

LQVDGKPPPPVIASAEDGPPYYRLAEEEETAGLGGVTGSGSFFREDKAPGMQRAIDQLDDLSLQEARRGLWSDTRADMVSDMLVPLKVASTSHRVPDSGP

EPILAFYGSRLTGRHKARKAPAGSKSDSNFSNLIRLSQASPEDAGPCRGSGWEEGEGRTTSTEPSVIPQREGDGPGIKDRPMDAE - UNI13367 - R

PGPELFDPSSCPGEWLSEPEWTLEGIRGSRAQGLPAHHPHPHGPPRTTSFLQHVGGHH

For any suggestions or comments, please send an email to unitrap@crg.es