Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040433 (Zbtb38)
Chromosomal location
Chr 9: 96585842 - 96632094 (-)
Description
zinc finger and BTB domain containing 38 Gene [Source:MGI Symbol;Acc:MGI:2442866]
RefSeq_dna
NM_175537 
RefSeq_peptide
NP_780746.2 
UniGene
Mm.443626 Mm.468782 
MGI
MGI:2442866 
Uniprot/SPTREMBL
Q3LR78 Q8BIL1 Q8BW24 Q8BW71 
Human Ortholog
ENSG00000177311 (ZBTB38)
Omim not available
UniTrap UNI20682
Vector Insertion
Chr 9: 96618729 - 96631710
Public Clones IST11996E3 (tigm) IST11811F4 (tigm) IST14623A10 (tigm) IST14332C4 (tigm)
IST14735B4 (tigm) IST11556B9 (tigm) IST12982G6 (tigm) IST15100F4 (tigm)
IST14566D11 (tigm) IST13609A11 (tigm) IST13044D11 (tigm) IST14313D8 (tigm)
Private Clones OST354931 (lexicon) OST286211 (lexicon) OST258364 (lexicon) OST50438 (lexicon)
OST34056 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14064
Vector Insertion
Chr 9: 96589449 - 96618628
Public Clones (sanger) D179C12 (ggtc) D158F06 (ggtc) CMHD-GT_141.1E11-3 (cmhd) IST14415H9 (tigm)
IST11761B9 (tigm) IST14958H3 (tigm) IST14012A6 (tigm)
Private Clones OST452216 (lexicon) OST376743 (lexicon) OST367568 (lexicon) OST344898 (lexicon)
OST276362 (lexicon) OST237225 (lexicon) OST232354 (lexicon) OST188116 (lexicon)
OST177282 (lexicon) OST165203 (lexicon) OST133390 (lexicon) OST97864 (lexicon)
OST94614 (lexicon) OST58380 (lexicon) OST54784 (lexicon) OST43353 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000093798
Sequence
ACGTTTGTGTTTGCAGAGCCCGTGTCAGTGGTTTGATTTTCAGCAAATGTGACAGTGGCCTTTGCAGTGGTCAGCTCTGAGCTTTGAACTCTCAGAGGAG

CAAAGGAGAAAAAAAAAAATTCAACACAGCACCTCCTTGGTTGCAGCCTCAGAGAATCCTTGGATAAGAAACTTCTTTTTTTCAGTCCTGTTTTGCTGTT

GATAAATTCAGTCCTCGTGATCACGGGGCTCTCAAGCTGCTCGGCGTATGATTTTTGGTGTGTGTGACAATCGCATCTAAAACTTGTGAGCAAGAAGACG

GAGAAATCAGTTGGTCTCCATCGCCTTACATAAAAATGGCCGAGCGTCTTGTTATGCTAACACTGCCCTGAGTGATACGCACAG - UNI20682 - AT

CTTGATATGGAAGACATGGCGGGCTCAGAACCAAGGATTTCCGAGTGATTTCTGCCAAAGCACAGAAGCTAACTCCGTCAAGGCTGGCGTGTTCTGAG -

 UNI14064 - ATGACAGTCATGTCCCTCTCCAGGGACCTCAAGGACGACTTTCACAGTGACACAGTACTCTCCATCTTAAATGAGCAGCGCATTCGGG

GCATCTTATGTGATGTCACCATCATCGTGGAAGACACCAAGTTTAAAGCCCACAGCAATGTCCTGGCCGCCTCAAGTCTTTATTTCAAAAACATCTTTTG

GAGCCATACGATCTGCATTTCCAGTCACGTCTTGGAGCTGGATGATCTGAAAGCCGAAGTGTTTACAGAAATACTTAATTATATCTACAGCTCTACCGTT

GTGGTCAAAAGACAGGAAACCGTCACTGATCTTGCAGCTGCAGGGAAAAAGCTGGGAATATCATTCTTAGAAGACCTTAGTGACCGCAACTTCTCAAATT

CCCCAGGTCCTTACGTAGTCTGCATTACTGAAAAGGGAGTGGTTAAAGAAGAAAAAAATGAGAAAAGGCACGAAGAACCAGCTGTCACTAATGGGCCAAG

GATCACAAACGCGTTTTCCATCATTGAGACGGAAAATAGTAATAACATGTTTTCTCCCCTGGACTTGAGAGCAAGCTTCAAAAAGGTGTCTGATTCCATG

AGGACAGCCAGCCTTTGCCAGGAGAGAGCCAGCGTCTGCCATGAGGTAGAGCCTGTCCGCACGCTTGCTGAGCACTCGTATGCCGTCTCGTCCATCACTG

AGGCCTACAGGAGTCAGCCTCCGAGGGAACAGGACAGCAGCTCATCTGCTAAAACAGGAAAAGAAACTGGTGATGCTCTTGCCACAAAAGCGAAGCCATG

CCGAAAGCCAAAGCCCCAAACCCAGGATTCTGACTCAACCACAGAAAATATGCCACTCTCTCTAGTAACCTGCCCAGAGGTGAATCAAGAAAGAAGCCCA

CAGCCAGCTCCAGATCTGTCACACTCAGAGCCTCCCAGCAATGAAGGGGATATCCATTTTCCCAGGGAAGATGAAAATCAGCCCTCTGATGCTCCGGGTC

CAGGAGCAGCAGAGGTCCCGCCCCTCGTTTATAACTGCAGCTGTTGTTCCAAGTCCTTTGACAGCAGCACGCTGCTCAGTGCCCACATGCAGCTCCACAA

GCCGACCCAGGAGCCTTTTGTGTGCAAGTACTGCAACAAGCAGTTCACCACCCTCAACAGACTGGACCGGCACGAGCAGATCTGCATGAGGTCTAGCCAC

GTGCCCATCCCAGGAGGAAACCCACCGTTCTTGGAAAACTACCCCACTATTGGTCAAGATGGAACTTCATTCAGAAGCCCGGAATCATTAGGGCCAGAAA

ATAGGATTGGCGAACTATCCAGCGCGGGGAGTGCCTTGTCAGACGCGGACCACATGGTGAAATTTGTGAACGGGCAGATGCTCTACAGCTGCATCGTGTG

CAAACGTAGTTATGTGACTTTGTCCAGCCTCCGGCGGCATGCAAATGTTCACTCGTGGAGAAGAACATACCCTTGCCATTACTGCAACAAGGTCTTTGCG

CTGGCTGAGTACAGGACGCGACATGAAATCTGGCACACTGGGGAGAGGCGGTACCAGTGCATTTTCTGTCTTGAAACTTTTATGACCTACTACATACTAA

AAAACCATCAGAAGTCCTTTCATGCCATAGATCACAGACTCTCCATCAATAAAAAAACAGCGAACGGAGGCTTGAAGCCTACTGTCTATCCATACAAACT

TTACAGGCTCTTGCCTATGAGATGCAAGAGGGCACCTTATAAGAGCTACCGGAATTCTTCCTATGTAAGTGCTCAAGGAAGCAGTCAAAGGGGTGAATCT

GCCCCTGATACGTTCATCGTTCCGAATCTGCAAAGCTCTGAAATGCCCACACTGGACTTCCAAGATGGCAGAAACACGTTGCCCAGCAGCCCTGCCGTGC

CAGTGGAAACACCTTCACGGCAGGGCGCACCCACTTCTGCCAGAGTAAAAAATGCAGAAGGCATCAAATGGAGGAAGCAGGCAGTGAAAACCAATCTCGT

CGATAACTTCGATTCAACTGAGGTGTCAGTTTCTTCCACTGGAAACACCGTCAGCGCCACCCTACAGACAGAGCCCGCATGTGTTTCATCTGTGGGCAAA

GGCAGTGAGCACTCGGCCTCTGTGATCAGCTACAGCGGCTCGGTGCCCTCCGTCATTGTGCACAGCAGCCAGTTCTCGTCGGTGATCAAGCACAGCAACA

CCATCGCTAGCCTGACCAACAGCAACCACAAGTCCCCTTCACAACCGGTGGTCAGCCCGTCCCTGATCAAGGACAGCAAGCCCGAGACAGATAAAGCCAG

TAAACCTGCAAGCAGACCCAAAAGCATTAAGGAGAAAAAGAAAACTGCTCCGAGTAACAGGGGAGAAATAACAGAGGAGGCAAAATATATTGCTGATCAC

GGAGGGTCTTCAGGCAAAACCACAAACGCTGAAGAAACCAGTAAGATTGAAACTTATATCGCAAAACCTGCTCTGCCCGGTACCTCCACAAATAGCAATG

TTGCACCCCTTTGCCAGATAACAGTAAAAATTGGGAACGAAGCCATCGTGAAAAGGCATATCCTTGGGTCTAAGCTGTTTTACAAAAGAGGGAGAAAACC

TAAGTATCAAATGCAGGAAGAGACACTGCCTCGGGAGAATGACCCAGAAACCCCTGGGGACAGCCCCCTTGGGCTTTGCCAGGCTGAATGTGTAGAGATG

AGTGAAGCATTTGATGAAGTGAGTGACCAGGACTCCACTGATAAGCCGTGGCGCCCATACTACAACTACAAACCCAAGAAGAAATCCAAACAGCTGAGAA

AAATGAGGAAAGTCAAATGGAGGAAGGAACGCAGGAGCAGAAGCCCCGTCGGCCGGTGCAGATACCCAGCCGAACTGGATCGTGCAGAGGTGAAACTGCC

CCCAGATAAGGCCTTCGAAGAAGAAGAAGAAGAAGAAGAGAATAAAGAGATGCCCAAGCTGCAGTGTGAGCTCTGTGATGGCTGCCCTGATGGGGCAGCA

GGGGCGGGAGCCGAAGGCAAGCCCCACCAGCATCTCACTTCGAAGCCTTACATCTGCGAGCTCTGTGCAAAGCAGTTCCAGAGCTCCTCCACACTCAAGA

TGCACATGAGATGCCACACTGGAGAAAAGCCGTATCAGTGCAAGACCTGTGGGCGGTGCTTCTCGGTGCAGGGGAACCTACAGAAGCACGAGCGCATACA

CCTGGGCGTGAAGGAGTTCATCTGTCAGTATTGTAACAAGGCATTCACACTCAACGAGACGCTCAAGATCCACGAGAGAATCCACACTGGGGAGAAGCGC

TACCACTGTCAGTTCTGCTTTCAGGGTTTCTTGTATCTCTCCACCAAACGGAACCACGAGCGGAGGCACATCCGGGAGCATGATGGGAAAGGCTTTGCTT

GCTTCCAGTGCCCCAAAATATGCAAAACAGCTGCTGCCCTCAGAATGCACCAAAAGAAACACTTATACAAGACCTTACCTAAGCAAGAGGAAACAGGCGA

CACGTGCCACGAGAACGCGGATCTCTTGGAAAGTCAGCTTTGCACTGATTCCGAAGACAGCGAACAAAAGGATGACATAAAAGCCTTTGCTGAAAACGTC

CTTTGAGTGACAACAACAG
Translation
 - UNI20682 -  - UNI14064 - MTVMSLSRDLKDDFHSDTVLSILNEQRIRGILCDVTIIVEDTKFKAHSNVLAASSLYFKNIFWSHTICISSH

VLELDDLKAEVFTEILNYIYSSTVVVKRQETVTDLAAAGKKLGISFLEDLSDRNFSNSPGPYVVCITEKGVVKEEKNEKRHEEPAVTNGPRITNAFSIIE

TENSNNMFSPLDLRASFKKVSDSMRTASLCQERASVCHEVEPVRTLAEHSYAVSSITEAYRSQPPREQDSSSSAKTGKETGDALATKAKPCRKPKPQTQD

SDSTTENMPLSLVTCPEVNQERSPQPAPDLSHSEPPSNEGDIHFPREDENQPSDAPGPGAAEVPPLVYNCSCCSKSFDSSTLLSAHMQLHKPTQEPFVCK

YCNKQFTTLNRLDRHEQICMRSSHVPIPGGNPPFLENYPTIGQDGTSFRSPESLGPENRIGELSSAGSALSDADHMVKFVNGQMLYSCIVCKRSYVTLSS

LRRHANVHSWRRTYPCHYCNKVFALAEYRTRHEIWHTGERRYQCIFCLETFMTYYILKNHQKSFHAIDHRLSINKKTANGGLKPTVYPYKLYRLLPMRCK

RAPYKSYRNSSYVSAQGSSQRGESAPDTFIVPNLQSSEMPTLDFQDGRNTLPSSPAVPVETPSRQGAPTSARVKNAEGIKWRKQAVKTNLVDNFDSTEVS

VSSTGNTVSATLQTEPACVSSVGKGSEHSASVISYSGSVPSVIVHSSQFSSVIKHSNTIASLTNSNHKSPSQPVVSPSLIKDSKPETDKASKPASRPKSI

KEKKKTAPSNRGEITEEAKYIADHGGSSGKTTNAEETSKIETYIAKPALPGTSTNSNVAPLCQITVKIGNEAIVKRHILGSKLFYKRGRKPKYQMQEETL

PRENDPETPGDSPLGLCQAECVEMSEAFDEVSDQDSTDKPWRPYYNYKPKKKSKQLRKMRKVKWRKERRSRSPVGRCRYPAELDRAEVKLPPDKAFEEEE

EEEENKEMPKLQCELCDGCPDGAAGAGAEGKPHQHLTSKPYICELCAKQFQSSSTLKMHMRCHTGEKPYQCKTCGRCFSVQGNLQKHERIHLGVKEFICQ

YCNKAFTLNETLKIHERIHTGEKRYHCQFCFQGFLYLSTKRNHERRHIREHDGKGFACFQCPKICKTAAALRMHQKKHLYKTLPKQEETGDTCHENADLL

ESQLCTDSEDSEQKDDIKAFAENVL

For any suggestions or comments, please send an email to unitrap@crg.es