Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040455 (Usp45)
Chromosomal location
Chr 4: 21703419 - 21765019 (+)
Description
ubiquitin specific petidase 45 Gene [Source:MGI (curated);Acc:Usp45-001]
RefSeq_peptide
NP_690038.1 
UniGene
Mm.427891 
MGI
MGI:101850 
Uniprot/SWISSPROT
Q8K387 
Human Ortholog
ENSG00000123552 (USP45)
Omim not available
UniTrap UNI11946
Vector Insertion
Chr 4: 21703465 - 21707487
Public Clones Q001B07 (ggtc)
Private Clones OST279770 (lexicon) OST261826 (lexicon) OST192838 (lexicon) OST178781 (lexicon)
OST144853 (lexicon) OST52528 (lexicon) OST34673 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23702
Vector Insertion
Chr 4: 21709056 - 21710029
Public Clones not available
Private Clones OST248627 (lexicon) OST186651 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000040429
Sequence
AGGCGCAGAAGCTCCTGCGTGTGGAAGCTGCGGCCCGGCGGGCGGG - UNI11946 - TAAATAACAGATGCGGGTAAAAGATCCATCAAAAGATCTA

CCTGAAAAAGGCAAAAGAAATAAAAGACCACTGCTGCCTCATGATGAAGATTCTTCCGATGACATTGCTG TAGGTCTAACGTGCCAGCACGTCAGTTAT

GCTGTCAGTGTGAATCATGTGAAGAAAGCAGTAGCTGAGAGTCTGTGGTCAGTTTGTTCAGAATGTTTGAAAGAGAGAAGATTCTGCGATGGACAGCCAG

TACTGCCTGCTGATGTTTGGTTGTGCCTCAAGTGTGGTTTGCAG - UNI23702 - GGATGCGGTAAAAACTCAGAAAGCCAGCATTCACTGAGACAC

TTCAAGAGCTCTGGGACAGAGTCCCATTGTGTTGTCATCAGCCTGAGTACATGGGTCATATG GTGTTATGAATGCAATGAAAAGTTGTCGACACATTGC

AACAAGAAAGTTTTGGCTCAAATAGTTGATTTTCTCCAGAAACATGCTTTTAAAACACAAACAG GTGCATTTTCTAGAATCATAAAACTTTGTGAAGAA

AAACGTGAAGCAGGTGAAATAAAGAAGGGGAAGAAAGGCTGCACTGTGCCATCTGTCAAAGGAATTACAAACTTAGGGAATACTTGCTTTTTTAATGCAG

TCATTCAG AACTTGGCTCAGACTTACATTCTTTTTGAACTGATGAACGAGATAAAAGAAGATGGCACCAAATTCAAGATTTCTCTTTCGTCAGCTCCAC

AGCTG GAGCCGTTAGTGGTGGAACTCTCGAGCCCAGGACCACTGACGTCAGCCTTGTTCCTGTTTCTTCACAGCATGAAGGAGGCTGAAAAAGGACCAC

TTTCTCCTAAAGTTCTTTTCAATCAGCTTTGTCAGAA GGCTCCTCGGTTTAAAGGTTTCCAGCAACAGGACAGCCAGGAGCTTCTGCACCATCTGTTGG

ATGCAGTGAGGACAGAGGAGACCAAG AGGATACAAGCCAGCATTCTAAAAGCCTTCAACAACCCAACTACCAAGACTGCTGATGATGAAACTAGAAAAA

AGGTCAAAG CCTATGGAAAGGAAGGTGTGAAGATGAACTTCATAGATCGCATCTTTATTGGCGAATTAACTAGCACAGTCATGTGTGAAGAATGTGCGA

AC ATCTCTACCATGAAGGATCCCTTCATTGATATCTCACTTCCTATCATAGAAGAAAGG AACCAACTAAGTCATGACAGAAAACATTTAAGAAAATGG

CCATCTGAAGAAGAGAAAACTGTTGTTACACACCCAAAGAATGACAACTTGGAAGCCAGCCCGCCTGCCAGCACCCTCAGCACTGAGGCGTCCCTGAACG

AGAGCCTCACTGACGGCAGCGAGAGGGACGCCAGCCTAGAGAGCAGCGTGGATGCCGACAGCGAGGCTTCGGAGCCCGAGATCGCTTCCAAGCAGCCTGT

GCTGCTGCGGTCCAGGGGTGATTCCTGCGGACACGCGGAGCAGCACCCACACCTCCCACTGGCAAGTGAATTGCCACAAGCCAAGGAGACGCATGGTGGC

GAGGAGGAAATGGCGGAAGCGATTGCTGAACTTCATTTGAGTGGCACTGTAACTGGCAATAGAGATTTCCACAGGGAAAAACAGCCACTAAATGTCCCAA

ATAATTTGTGTTTTTCAGAGGGAAAACATACGAGGCTTCACAGTGCCCAAAATGCTTTTCAGACCCTTTCTCAGAGTTATGTAACTACTTCTAAAGAATG

CTCAGTCCAGTCCTGTCTCTACCAGTTCACATCCATGGAGTTATTAATGGGCAACAATAAGCTGCTCTGTGAGGACTGTACTGAAAAGAGACGGAAGTGC

CACAAAGAAACCAGCTCCGCAG AAAAGAAAGCAGGAGGAGTTTATACCAATGCCAGGAAGCAACTCCTCATATCTGCCGTTCCTGCTATCCTAATCCTT

CATCTTAAAAGATTCCACCAG GCTGGCTTGAGTCTTCGTAAAGTAAACAGACATGTAGACTTTCCGCTTACCCTTGACTTGGCACCGTTCTGTGCGGCT

ACCTGTAAG AATATAAGTGTGGGGGAGAAGGTTCTCTACGGTCTCTACGGTATAGTGGAGCACAGCGGCTCCATGAGAGGAGGCCACTACACTGCTTAC

GTGAAAGTGAGAGTACCCTCCAGGAAGCTGTCCGAGTGCATCACCGGGAGGAAGACTGCAGCCG GTTTGAAAGAACCTGATGGTGAATTGGGAGGCCAC

TGGGTCCATGTCAGCGACACCTATGTGCAGGTGGTTCCAGAGTCAAGAGCCCTGAGTGCACAAGCTTATCTTCTTTTTTATGAAAGAATATTATAATATC

TGTTCATTGTTATTTAGTTCATTTTTATTTTAATGCTGAAGTCGTAACCATAATATGTAATGTGCCTTCTTAGTCTTTAGGAATAGTGCATCCTTCCAGC

GTTATTTAACTCTTTCAACATGTGGTGAATCCTTTAAAAAAAAATTAATTAATTTGACAGGCAGTTGTGCATGCCTTTAATTCCAGCACTTGGGAGGCAG

AGGCAGACAGATCTCTGTTTGAGGCCAACTAGGGCTATTCAATAAAACCTTGTCTTGAAATATTAAACAAAAAGTTAATTAATGCTTTCAAATCTATATT

CTTTTTTTTTCTTTTTTTTTGCTTTTGTGAGACAGGGTTTCTCTGTGTAGCCCTGGCTGTCCTGGAACTCACTTTGTATCACTTTGTAGACCAGGCTGGC

CTCGAACTCAGAAATCCACCTACCTCTGCCTCCCAAGTGCTGGCATTAAAGGCGTGCGCCACCACTGCCTGGCTCAAATCTATATTTTTAAATGTAAAAA

CATGTTTTATGTTAATTTTCATGTCCATGGAAATTGCCCCTACACACACACACACAGAGTTGATAGTAAAGCAACCCCCTCTATGATATGACTCATCCTT

ACATGCATTCAAAGATGATGCTAAATTGGATCTTTAGTATACTATTTCCTAATGTAATACAACCTTCCTGAGTGGATCCAATATATCTTATGCTACAATT

TGCTTACTTTTTGTTGAAGCCTTTTTTAAGCTTGGCTGTTTTGAATCATACTTCACATTTTTATGTGCTAGTTATTTTTCTAGTAAACATTGATGTGAGT

TTATAACTATGAAAGGAAAATCATACATCCTTGCACCACCCCACTTTAAATCATCTCAGGGCTCTGCAGTGGTGTGTGTGTTAGTCTATAGGAAAAGTTT

CTAGAACAGTCTGAACTAGTGCCTAATGTAACATAATTAATTTTTCATATTTTATGTGAGTCAGTAGTATAAAAAGGAGCCATTGTAATTTTGGTAGTGT

GAGTTTACAAGTAATGAATTGATTCGCTTATTGCTTTGAATATTTGAAGGTATTGAAACATTTCATAAACTAATCATTTGCAGTCTTTGAAAGATAATTT

ACAACACATAAAACTGGTAAATAGAAGTTATAGTCTATATAGGAATATAGAATACTTTAAAGTTTAAGGATATCTTTGAACTGTAAACCACCAAATTATA

TTTATAAATGGTAGAGATCATATTCTTATAACCAACAATGAATATATAATACTTTTTTACTTCTATACATTAATACATGTTAAGCATAGTTTTGTCTTCA

TAAGCATTTATTTAAAACTTCAGGTGGATAGTTAGGGTTGTAGTTCAATGGCAAAGCACTTGCCTGGTTCCATCCCTAGCAAAACAAAGAAAATATTCAG

GTGGGCTTGGCTACTTTCATGGGACACAGACTTGCCACTTCTGTTCCCCTTAAATAAGCAGTAACACAGAATAGTTTCTTCTAGCATTCAAAGGATTGAA

CTGTGAAAACTTAGCATGAAAAATATTACTACCAAGATTTTCAATAATCAATGAAGTGGCTCACTGATACATAGTATTGAATCAAGATGTAAGGGAACAG

GTTCAATGTCTTAGTCATCAGTGCCTGTGTTTGATTCTATGGGCAAATGTGAGGGAGAGAGGCTGTAAACTGTCCAGACCTTTAGCCAGGATGGAACCTT

CTTAACATGTGTAACATAAAGTCCCCAGTGTTGCCTCTTGATATGTGGCTGGGTGAAACTGATTGTCTAATGGAGACATTTTAAGATTGTGGAGAAATTT

TCAATGGTATTTGAATTTTTTTAATTGAAGGTGAAGAAATATATTTTATCTGTAGAGCCCAGTTGTGTCCTCTAAAAAGAACTTTCCAGTGTCTTCTGTT

TCATCAGACATTCAGTGTTATTAATCTATTGACACGGAAGAGTCTAGCACCAGAGCAATGAATGAGAAAAATAATTTATTTGTTCAAGCTAGCCTGTCAT

AGCAGTTGCACCCACACCCCCAAACAAATGCAAGCGGTCAGCCTTTTTCCCCCCTCTCTCCTGGAAAAGATACTATTAAGACATGTACAATCTAAGCAGG

TTCCAATACCGGGCATATGATAGTATTTTATGAGCCTTTAAAACAGAAAAACCTGCTGAGTGATGGTGGCCCATGCCTTTAGATTCAGCACTTGGGAGGC

AGAGGCAGGTGGATTTGAGTTCAAGGACACCCTGGTCCACAGAGCAGGTTCCAGGAAAGCCAAGACAACACAGAGAAACCTTGCCTGAAAAACCTTGGGG

AAAAAAAAAACACCCTAAAATCTATATGATTTTATACATTATTCTAGTAGTGATGTACAAATAAAATGTTCATTTATTACCTAGTTCTGAGGAGATTCTG

GAATGTATTTTTTTTTAATGACCTAAAGTTTGAGTGTTTTTCTTGTCACCTGAAAATGTAGGAAAATGGTTTGATTTGATATCTAGGAATTTCTTATCAA

GCTTATGTAATATAGAAAAATCACCCAGATCTACACTTAAATTTTTGTTCTTACTTTGAAGTTTTCCAAAGCACATTTGTAGAAATTTTAAATTGTGAGG

CCACTGTACTAACAGATTACCTCAGGAAACCGTGCAAACAAACAAGAATGTTTACAGATCCGCACAACTAGTCAGTGCTTTGGCACCGTGAATTTGAAAG

GTAAAAGAGAGAAGTTTTTATCTAGAAACTGGTTTACAGGGTACCTCTAGCCCCAGTTCTCCCCTGACTTTCCCATATTTAAAATAATAAAATTCTGATG

ATGTGCCAATTATGTGAATGCTTGTGACATAAACAAATATACATCTGTATTTAAGATTTGTTGTTTAATGTTTTAAAAAATAATATGAAGACTGCTTATG

TAGGTGGTCAAGGGGATGATCATATATCAACAGAGCTATTTTACCATAGTTCTTAGCTTGCATGTGTGATTAATTAGTGATTTTTATGTAATACTTGAAT

AAGATATCCTGAAGATATGAAATGTCTTCGTGAAATGTAGCTGTGAAATGTCACCGCACATCAAATTTTTATAGTACAAAATAACATCCTGCCTACTTTC

ATGAACTTTATACTCAGCTTATTTTTCTGCATGACATCTGGTCATATAAACCTAAACCAAATATGTGCGATAAAATCAAGCTTTCAGCTAGCATCCATTG

CAGTATTAGAGAAATGATTTCTGCATTAAAATGTTTTTGTTCATGCAGAAATCATCAATTGAAATGTGTTTAAAAGATGATTATTTTTAGGTATCAGTAA

TACATTCATGGTATCATTCCTTCTCTTTCATCCAGTTTTACAGTATTTTAAAAATATCTGTGTAACTTATTGAGCATTATTTGATCATTGCTGTATGTAA

AAGATCACAATAAATATTAGATTCTTATGTTAATTGATTAGGCCTAGAGTTTTTGCATTATACATTGTTAGCAGAATGTTAATAAACATTGTGTCATTGC

CTA
Translation
 - UNI11946 - MRVKDPSKDLPEKGKRNKRPLLPHDEDSSDDIAV VGLTCQHVSYAVSVNHVKKAVAESLWSVCSECLKERRFCDGQPVLPADVWL

CLKCGLQ - UNI23702 - GCGKNSESQHSLRHFKSSGTESHCVVISLSTWVIW WCYECNEKLSTHCNKKVLAQIVDFLQKHAFKTQTG GAFSRII

KLCEEKREAGEIKKGKKGCTVPSVKGITNLGNTCFFNAVIQ NLAQTYILFELMNEIKEDGTKFKISLSSAPQL EPLVVELSSPGPLTSALFLFLHSMK

EAEKGPLSPKVLFNQLCQK KAPRFKGFQQQDSQELLHHLLDAVRTEETK RIQASILKAFNNPTTKTADDETRKKVKA AYGKEGVKMNFIDRIFIGEL

TSTVMCEECAN ISTMKDPFIDISLPIIEER NQLSHDRKHLRKWPSEEEKTVVTHPKNDNLEASPPASTLSTEASLNESLTDGSERDASLESSVDADSE

ASEPEIASKQPVLLRSRGDSCGHAEQHPHLPLASELPQAKETHGGEEEMAEAIAELHLSGTVTGNRDFHREKQPLNVPNNLCFSEGKHTRLHSAQNAFQT

LSQSYVTTSKECSVQSCLYQFTSMELLMGNNKLLCEDCTEKRRKCHKETSSAE EKKAGGVYTNARKQLLISAVPAILILHLKRFHQ AGLSLRKVNRHV

DFPLTLDLAPFCAATCK NISVGEKVLYGLYGIVEHSGSMRGGHYTAYVKVRVPSRKLSECITGRKTAAG GLKEPDGELGGHWVHVSDTYVQVVPESRA

LSAQAYLLFYERIL
Transcript ENSMUST00000108232
Sequence
GCTGCGGCCCGGCGGGCGGG - UNI11946 - TAAATAACAGATGCGGGTAAAAGATCCATCAAAAGATCTACCTGAAAAAGGCAAAAGAAATAAAAG

ACCACTGCTGCCTCATGATGAAGATTCTTCCGATGACATTGCTG TAGGTCTAACGTGCCAGCACGTCAGTTATGCTGTCAGTGTGAATCATGTGAAGAA

AGCAGTAGCTGAGAGTCTGTGGTCAGTTTGTTCAGAATGTTTGAAAGAGAGAAGATTCTGCGATGGACAGCCAGTACTGCCTGCTGATGTTTGGTTGTGC

CTCAAGTGTGGTTTGCAG - UNI23702 - GGATGCGGTAAAAACTCAGAAAGCCAGCATTCACTGAGACACTTCAAGAGCTCTGGGACAGAGTCCCA

TTGTGTTGTCATCAGCCTGAGTACATGGGTCATATG GTGTTATGAATGCAATGAAAAGTTGTCGACACATTGCAACAAGAAAGTTTTGGCTCAAATAGT

TGATTTTCTCCAGAAACATGCTTTTAAAACACAAACAG GTGCATTTTCTAGAATCATAAAACTTTGTGAAGAAAAACGTGAAGCAGGTGAAATAAAGAA

GGGGAAGAAAGGCTGCACTGTGCCATCTGTCAAAGGAATTACAAACTTAGGGAATACTTGCTTTTTTAATGCAGTCATTCAG AACTTGGCTCAGACTTA

CATTCTTTTTGAACTGATGAACGAGATAAAAGAAGATGGCACCAAATTCAAGATTTCTCTTTCGTCAGCTCCACAGCTG GAGCCGTTAGTGGTGGAACT

CTCGAGCCCAGGACCACTGACGTCAGCCTTGTTCCTGTTTCTTCACAGCATGAAGGAGGCTGAAAAAGGACCACTTTCTCCTAAAGTTCTTTTCAATCAG

CTTTGTCAGAA GGCTCCTCGGTTTAAAGGTTTCCAGCAACAGGACAGCCAGGAGCTTCTGCACCATCTGTTGGATGCAGTGAGGACAGAGGAGACCAAG

 AGGATACAAGCCAGCATTCTAAAAGCCTTCAACAACCCAACTACCAAGACTGCTGATGATGAAACTAGAAAAAAGGTCAAAG CCTATGGAAAGGAAGG

TGTGAAGATGAACTTCATAGATCGCATCTTTATTGGCGAATTAACTAGCACAGTCATGTGTGAAGAATGTGCGAAC ATCTCTACCATGAAGGATCCCTT

CATTGATATCTCACTTCCTATCATAGAAGAAAGG AACCAACTAAGTCATGACAGAAAACATTTAAGAAAATGGCCATCTGAAGAAGAGAAAACTGTTGT

TACACACCCAAAGAATGACAACTTGGAAGCCAGCCCGCCTGCCAGCACCCTCAGCACTGAGGCGTCCCTGAACGAGAGCCTCACTGACGGCAGCGAGAGG

GACGCCAGCCTAGAGAGCAGCGTGGATGCCGACAGCGAGGCTTCGGAGCCCGAGATCGCTTCCAAGCAGCCTGTGCTGCTGCGGTCCAGGGGTGATTCCT

GCGGACACGCGGAGCAGCACCCACACCTCCCACTGGCAAGTGAATTGCCACAAGCCAAGGAGACGCATGGTGGCGAGGAGGAAATGGCGGAAGCGATTGC

TGAACTTCATTTGAGTGGCACTGTAACTGGCAATAGAGATTTCCACAGGGAAAAACAGCCACTAAATGTCCCAAATAATTTGTGTTTTTCAGAGGGAAAA

CATACGAGGCTTCACAGTGCCCAAAATGCTTTTCAGACCCTTTCTCAGAGTTATGTAACTACTTCTAAAGAATGCTCAGTCCAGTCCTGTCTCTACCAGT

TCACATCCATGGAGTTATTAATGGGCAACAATAAGCTGCTCTGTGAGGACTGTACTGAAAAGAGACGGAAGTGCCACAAAGAAACCAGCTCCGCAG AAA

AGAAAGCAGGAGGAGTTTATACCAATGCCAGGAAGCAACTCCTCATATCTGCCGTTCCTGCTATCCTAATCCTTCATCTTAAAAGATTCCACCAG GCTG

GCTTGAGTCTTCGTAAAGTAAACAGACATGTAGACTTTCCGCTTACCCTTGACTTGGCACCGTTCTGTGCGGCTACCTGTAAG AATATAAGTGTGGGGG

AGAAGGTTCTCTACGGTCTCTACGGTATAGTGGAGCACAGCGGCTCCATGAGAGGAGGCCACTACACTGCTTACGTGAAAGTGAGAGTACCCTCCAGGAA

GCTGTCCGAGTGCATCACCGGGAGGAAGACTGCAGCCG GTTTGAAAGAACCTGATGGTGAATTGGGAGGCCACTGGGTCCATGTCAGCGACACCTATGT

GCAGGTGGTTCCAGAGTCAAGAGCCCTGAGTGCACAAGCTTATCTTCTTTTTTATGAAAGAATATTATAATATCTGTTCATTGTTATTTAGTTCATTTTT

ATTTTAATGCTGAAGTCGTAACCATAATATGTAATGTGCCTTCTTAGTCTTTAGGAATAGTGCATCCTTCCAGCGTTATTTAACTCTTTCAACATGTGGT

GAATCCTTTAAAAAAAAATTAATTAATTTGACAGGCAGTTGTGCATGCCTTTAATTCCAGCACTTGGGAGGCAGAG GCAGGTGGATTTGAGTTCAAGGA

CACCCTGGTCCACAGAGCAGGTTCCAGGAAAGCCAAGACAACACAGAGAAACCTTGCCTGAAAAACCTTGGGGAAAAAAAAAACACCCTAAAATCTATAT

GATTTTATACATTATTCTAGTAGTGATGTACAAATAAAATGTTCATTTATTACCTAGTTCTGAGGAGATTCTGGAATGTATTTTTTTTTAATGACCTAAA

GTTTGAGTGTTTTTCTTGTCACCTGAAAATGTAGGAAAATGGTTTGATTTGATATCTAGGAATTTCTTATCAAGCTTATGTAATATAGAAAAATCACCCA

GATCTACACTTAAATTTTTGTTCTTACTTTGAAGTTTTCCAAAGCACATTTGTAGAAATTTTAAATTGTGAGGCCACTGTACTAACAGATTACCTCAGGA

AACCGTGCAAACAAACAAGAATGTTTACAGATCCGCACAACTAGTCAGTGCTTTGGCACCGTGAATTTGAAAGGTAAAAGAGAGAAGTTTTTATCTAGAA

ACTGGTTTACAGGGTACCTCTAGCCCCAGTTCTCCCCTGACTTTCCCATATTTAAAATAATAAAATTCTGATGATGTGCCAATTATGTGAATGCTTGTGA

CATAAACAAATATACATCTGTATTTAAGATTTGTTGTTTAATGTTTTAAAAAATAATATGAAGACTGCTTATGTAGGTGGTCAAGGGGATGATCATATAT

CAACAGAGCTATTTTACCATAGTTCTTAGCTTGCATGTGTGATTAATTAGTGATTTTTATGTAATACTTGAATAAGATATCCTGAAGATATGAAATGTCT

TCGTGAAATGTAGCTGTGAAATGTCACCGCACATCAAATTTTTATAGTACAAAATAACATCCTGCCTACTTTCATGAACTTTATACTCAGCTTATTTTTC

TGCATGACATCTGGTCATATAAACCTAAACCAAATATGTGCGATAAAATCAAGCTTTCAGCTAGCATCCATTGCAGTATTAGAGAAATGATTTCTGCATT

AAAATGTTTTTGTTCATGCAGAAATCATCAATTGAAATGTGTTTAAAAGATGATTATTTTTAGGTATCAGTAATACATTCATGGTATCATTCCTTCTCTT

TCATCCAGTTTTACAGTATTTTAAAAATATCTGTGTAACTTATTGAGCATTATTTGATCATTGCTGTATGTAAAAGATCACAATAAATATTAGATTCTTA

TGTTAATTGATTAGGCCTAGAGTTTTTGCATTATACATTGTTAGCAGAATGTTAATAAACATTGTGTCATTGCCT
Translation
 - UNI11946 - MRVKDPSKDLPEKGKRNKRPLLPHDEDSSDDIAV VGLTCQHVSYAVSVNHVKKAVAESLWSVCSECLKERRFCDGQPVLPADVWL

CLKCGLQ - UNI23702 - GCGKNSESQHSLRHFKSSGTESHCVVISLSTWVIW WCYECNEKLSTHCNKKVLAQIVDFLQKHAFKTQTG GAFSRII

KLCEEKREAGEIKKGKKGCTVPSVKGITNLGNTCFFNAVIQ NLAQTYILFELMNEIKEDGTKFKISLSSAPQL EPLVVELSSPGPLTSALFLFLHSMK

EAEKGPLSPKVLFNQLCQK KAPRFKGFQQQDSQELLHHLLDAVRTEETK RIQASILKAFNNPTTKTADDETRKKVKA AYGKEGVKMNFIDRIFIGEL

TSTVMCEECAN ISTMKDPFIDISLPIIEER NQLSHDRKHLRKWPSEEEKTVVTHPKNDNLEASPPASTLSTEASLNESLTDGSERDASLESSVDADSE

ASEPEIASKQPVLLRSRGDSCGHAEQHPHLPLASELPQAKETHGGEEEMAEAIAELHLSGTVTGNRDFHREKQPLNVPNNLCFSEGKHTRLHSAQNAFQT

LSQSYVTTSKECSVQSCLYQFTSMELLMGNNKLLCEDCTEKRRKCHKETSSAE EKKAGGVYTNARKQLLISAVPAILILHLKRFHQ AGLSLRKVNRHV

DFPLTLDLAPFCAATCK NISVGEKVLYGLYGIVEHSGSMRGGHYTAYVKVRVPSRKLSECITGRKTAAG GLKEPDGELGGHWVHVSDTYVQVVPESRA

LSAQAYLLFYERIL 
Transcript ENSMUST00000065111
Sequence
GCTGCGGCCCGGCGGGCGGG - UNI11946 - TAAATAACAGATGCGGGTAAAAGATCCATCAAAAGATCTACCTGAAAAAGGCAAAAGAAATAAAAG

ACCACTGCTGCCTCATGATGAAGATTCTTCCGATGACATTGCTG TAGGTCTAACGTGCCAGCACGTCAGTTATGCTGTCAGTGTGAATCATGTGAAGAA

AGCAGTAGCTGAGAGTCTGTGGTCAGTTTGTTCAGAATGTTTGAAAGAGAGAAGATTCTGCGATGGACAGCCAGTACTGCCTGCTGATGTTTGGTTGTGC

CTCAAGTGTGGTTTGCAG - UNI23702 - GGATGCGGTAAAAACTCAGAAAGCCAGCATTCACTGAGACACTTCAAGAGCTCTGGGACAGAGTCCCA

TTGTGTTGTCATCAGCCTGAGTACATGGGTCATATG GTGTTATGAATGCAATGAAAAGTTGTCGACACATTGCAACAAGAAAGTTTTGGCTCAAATAGT

TGATTTTCTCCAGAAACATGCTTTTAAAACACAAACAG GTGCATTTTCTAGAATCATAAAACTTTGTGAAGAAAAACGTGAAGCAGGTGAAATAAAGAA

GGGGAAGAAAGGCTGCACTGTGCCATCTGTCAAAGGAATTACAAACTTAGGGAATACTTGCTTTTTTAATGCAGTCATTCAG AACTTGGCTCAGACTTA

CATTCTTTTTGAACTGATGAACGAGATAAAAGAAGATGGCACCAAATTCAAGATTTCTCTTTCGTCAGCTCCACAGCTG GAGCCGTTAGTGGTGGAACT

CTCGAGCCCAGGACCACTGACGTCAGCCTTGTTCCTGTTTCTTCACAGCATGAAGGAGGCTGAAAAAGGACCACTTTCTCCTAAAGTTCTTTTCAATCAG

CTTTGTCAGAA GGCTCCTCGGTTTAAAGGTTTCCAGCAACAGGACAGCCAGGAGCTTCTGCACCATCTGTTGGATGCAGTGAGGACAGAGGAGACCAAG

 AGGATACAAGCCAGCATTCTAAAAGCCTTCAACAACCCAACTACCAAGACTGCTGATGATGAAACTAGAAAAAAGGTCAAAG CCTATGGAAAGGAAGG

TGTGAAGATGAACTTCATAGATCGCATCTTTATTGGCGAATTAACTAGCACAGTCATGTGTGAAGAATGTGCGAAC ATCTCTACCATGAAGGATCCCTT

CATTGATATCTCACTTCCTATCATAGAAGAAAGG GTTTCAAAACCTGTACTTTTGGGGAAAATGAGTAAATGCAGAAGTTTACAAGAAACAGACCAAGA

TCATAACAAGGGCACCGTGACTGTAGGAAATGCCCATCAACCCAGAGCTTCCAGGAAGCACTCCTCACCTAACGACAAG AACCAACTAAGTCATGACAG

AAAACATTTAAGAAAATGGCCATCTGAAGAAGAGAAAACTGTTGTTACACACCCAAAGAATGACAACTTGGAAGCCAGCCCGCCTGCCAGCACCCTCAGC

ACTGAGGCGTCCCTGAACGAGAGCCTCACTGACGGCAGCGAGAGGGACGCCAGCCTAGAGAGCAGCGTGGATGCCGACAGCGAGGCTTCGGAGCCCGAGA

TCGCTTCCAAGCAGCCTGTGCTGCTGCGGTCCAGGGGTGATTCCTGCGGACACGCGGAGCAGCACCCACACCTCCCACTGGCAAGTGAATTGCCACAAGC

CAAGGAGACGCATGGTGGCGAGGAGGAAATGGCGGAAGCGATTGCTGAACTTCATTTGAGTGGCACTGTAACTGGCAATAGAGATTTCCACAGGGAAAAA

CAGCCACTAAATGTCCCAAATAATTTGTGTTTTTCAGAGGGAAAACATACGAGGCTTCACAGTGCCCAAAATGCTTTTCAGACCCTTTCTCAGAGTTATG

TAACTACTTCTAAAGAATGCTCAGTCCAGTCCTGTCTCTACCAGTTCACATCCATGGAGTTATTAATGGGCAACAATAAGCTGCTCTGTGAGGACTGTAC

TGAAAAGAGACGGAAGTGCCACAAAGAAACCAGCTCCGCAG AAAAGAAAGCAGGAGGAGTTTATACCAATGCCAGGAAGCAACTCCTCATATCTGCCGT

TCCTGCTATCCTAATCCTTCATCTTAAAAGATTCCACCAG GCTGGCTTGAGTCTTCGTAAAGTAAACAGACATGTAGACTTTCCGCTTACCCTTGACTT

GGCACCGTTCTGTGCGGCTACCTGTAAG AATATAAGTGTGGGGGAGAAGGTTCTCTACGGTCTCTACGGTATAGTGGAGCACAGCGGCTCCATGAGAGG

AGGCCACTACACTGCTTACGTGAAAGTGAGAGTACCCTCCAGGAAGCTGTCCGAGTGCATCACCGGGAGGAAGACTGCAGCCG GTTTGAAAGAACCTGA

TGGTGAATTGGGAGGCCACTGGGTCCATGTCAGCGACACCTATGTGCAGGTGGTTCCAGAGTCAAGAGCCCTGAGTGCACAAGCTTATCTTCTTTTTTAT

GAAAGAATATTATAATATCTGTTCATTGTTATTTAGTTCATTTTTATTTTAATGCTGAAGTCGTAACCATAATATGTAATGTGCCTTCTTAGTCTTTAGG

AATAGTGCATCCTTCCAGCGTTATTTAACTCTTTCAACATGTGGTGAATCCTTTAAAAAAAAATTAATTAATTTGACAGGCAGTTGTGCATGCCTTTAAT

TCCAGCACTTGGGAGGCAGAG GCAGGTGGATTTGAGTTCAAGGACACCCTGGTCCACAGAGCAGGTTCCAGGAAAGCCAAGACAACACAGAGAAACCTT

GCCTGAAAAACCTTGGGGAAAAAAAAAACACCCTAAAATCTATATGATTTTATACATTATTCTAGTAGTGATGTACAAATAAAATGTTCATTTATTACCT

AGTTCTGAGGAGATTCTGGAATGTATTTTTTTTTAATGACCTAAAGTTTGAGTGTTTTTCTTGTCACCTGAAAATGTAGGAAAATGGTTTGATTTGATAT

CTAGGAATTTCTTATCAAGCTTATGTAATATAGAAAAATCACCCAGATCTACACTTAAATTTTTGTTCTTACTTTGAAGTTTTCCAAAGCACATTTGTAG

AAATTTTAAATTGTGAGGCCACTGTACTAACAGATTACCTCAGGAAACCGTGCAAACAAACAAGAATGTTTACAGATCCGCACAACTAGTCAGTGCTTTG

GCACCGTGAATTTGAAAGGTAAAAGAGAGAAGTTTTTATCTAGAAACTGGTTTACAGGGTACCTCTAGCCCCAGTTCTCCCCTGACTTTCCCATATTTAA

AATAATAAAATTCTGATGATGTGCCAATTATGTGAATGCTTGTGACATAAACAAATATACATCTGTATTTAAGATTTGTTGTTTAATGTTTTAAAAAATA

ATATGAAGACTGCTTATGTAGGTGGTCAAGGGGATGATCATATATCAACAGAGCTATTTTACCATAGTTCTTAGCTTGCATGTGTGATTAATTAGTGATT

TTTATGTAATACTTGAATAAGATATCCTGAAGATATGAAATGTCTTCGTGAAATGTAGCTGTGAAATGTCACCGCACATCAAATTTTTATAGTACAAAAT

AACATCCTGCCTACTTTCATGAACTTTATACTCAGCTTATTTTTCTGCATGACATCTGGTCATATAAACCTAAACCAAATATGTGCGATAAAATCAAGCT

TTCAGCTAGCATCCATTGCAGTATTAGAGAAATGATTTCTGCATTAAAATGTTTTTGTTCATGCAGAAATCATCAATTGAAATGTGTTTAAAAGATGATT

ATTTTTAGGTATCAGTAATACATTCATGGTATCATTCCTTCTCTTTCATCCAGTTTTACAGTATTTTAAAAATATCTGTGTAACTTATTGAGCATTATTT

GATCATTGCTGTATGTAAAAGATCACAATAAATATTAGATTCTTATGTTAATTGATTAGGCCTAGAGTTTTTGCATTATACATTGTTAGCAGAATGTTAA

TAAACATTGTGTCATTGCCT
Translation
 - UNI11946 - MRVKDPSKDLPEKGKRNKRPLLPHDEDSSDDIAV VGLTCQHVSYAVSVNHVKKAVAESLWSVCSECLKERRFCDGQPVLPADVWL

CLKCGLQ - UNI23702 - GCGKNSESQHSLRHFKSSGTESHCVVISLSTWVIW WCYECNEKLSTHCNKKVLAQIVDFLQKHAFKTQTG GAFSRII

KLCEEKREAGEIKKGKKGCTVPSVKGITNLGNTCFFNAVIQ NLAQTYILFELMNEIKEDGTKFKISLSSAPQL EPLVVELSSPGPLTSALFLFLHSMK

EAEKGPLSPKVLFNQLCQK KAPRFKGFQQQDSQELLHHLLDAVRTEETK RIQASILKAFNNPTTKTADDETRKKVKA AYGKEGVKMNFIDRIFIGEL

TSTVMCEECAN ISTMKDPFIDISLPIIEER VSKPVLLGKMSKCRSLQETDQDHNKGTVTVGNAHQPRASRKHSSPNDK NQLSHDRKHLRKWPSEEEK

TVVTHPKNDNLEASPPASTLSTEASLNESLTDGSERDASLESSVDADSEASEPEIASKQPVLLRSRGDSCGHAEQHPHLPLASELPQAKETHGGEEEMAE

AIAELHLSGTVTGNRDFHREKQPLNVPNNLCFSEGKHTRLHSAQNAFQTLSQSYVTTSKECSVQSCLYQFTSMELLMGNNKLLCEDCTEKRRKCHKETSS

AE EKKAGGVYTNARKQLLISAVPAILILHLKRFHQ AGLSLRKVNRHVDFPLTLDLAPFCAATCK NISVGEKVLYGLYGIVEHSGSMRGGHYTAYVKV

RVPSRKLSECITGRKTAAG GLKEPDGELGGHWVHVSDTYVQVVPESRALSAQAYLLFYERIL 

For any suggestions or comments, please send an email to unitrap@crg.es