Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040462 (Os9)
Chromosomal location
Chr 10: 126532708 - 126558181 (-)
Description
amplified in osteosarcoma Gene [Source:MGI Symbol;Acc:MGI:1924301]
RefSeq_dna
NM_177614 
RefSeq_peptide
NP_808282.1 
MGI
MGI:1924301 
Uniprot/SPTREMBL
Q8K2C7 Q922S5 
Human Ortholog
ENSG00000135506 (AC025165.27)
Omim not available
UniTrap UNI1968
Vector Insertion
Chr 10: 126537352 - 126556154
Public Clones CC0460 (sanger) RST087 (baygenomics) E023C07 (ggtc) E061G11 (ggtc)
Private Clones OST312235 (lexicon)
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32033
Vector Insertion
Chr 10: 126535886 - 126536514
Public Clones IST10533G10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000080975
Sequence
GCGGAAGATGGCGGCGGAGGTGCTGCTGTCCAGTCTGTTGGGATTGCTATTTCTAGGGCTCCTGTTACCTGCGCGTCTGACGGGCGGTGTCGGGAGCCTG

AATTTGGAGGAGCTGAGTGAGATGCGTTATGGCATCCAGATCTTGCCGTTGCCTGTCATGGGAGGGCAG AGCCAAGCTTCAGACGTGGTGGTTGTGTCT

TCAAAGTACAAACAGCGCTATGAGTGCCGCCTACCAGCTGGAGCTATTCACTTCCAACGTGAAAGAGAGGAGGAGACGCCTGCTTACCAGGGGCCCGGGA

TCCCTGAATTGTTGAGCCCAATGAGAGATGCCCCTTGTTTGCTGAAG ACCAAGGACTGGTGGACATATGAATTCTGTTATGGACGTCATATCCAGCAGT

ACCATATGGAAG ACTCGGAGATCAAAGGTGACGTCCTCTATCTTGGCCACTACCAGTCCTCCTTCAACTGGGACGACGAAACAGCCAAG GCTTCCAAG

CAGCATCGGCTGAAACGCTACCACAGCCAGACCTACGGCAACGGGTCCAAATGTGATCTCAACGGGAAGCCCCGAGAAGCTGAAGTTCGG - UNI1968

 - TTCCTGTGTGACGAGGGTGCGGGCATATCTGGGGACTACATTGACCGAGTAGATGAACCCGTCTCCTGCTCCTACGTACTGACCATTCGCACGTCAA

GGCTCTGCCCGCATCCTCTCCTCCGGCCACCAGCCAGCGCTGCCCCACAGGCCATTCTTTGTCACCCAGCCCTGCAGCCTGATGAGTACATGGCCTACCT

CCAGAGGCAAGCTG AGTCAAAGCAGCATGAAGAGAAAACCACAGAGGAAGTCCAGGACACAGACCGCCAAGTGTGGAGTGGGAGCAAGGCTGCCGGAGC

ACCCCCAAAGAAAGAAG ATGTCAGCCCAGCCAAGGAAGAGAAGGAATCAGAGCTCTGGAAGCTTCAGGGGCCAGAGGAGCAGGCAGCAGCAAGAGAGGA

GGCGCAGGCAGGG - UNI32033 - GAACAGGACCTGAACCACGAGGCCGCAGCAGATCCAGCTCCAAGCCCTCCCAATG - UNI32033 - ATTT

TCAGAATAACGTGCAGGTGAAACTCATCCGGAGTCCCGCAGACTTGATTCGACTGATTGAGGAGCTGAAAGCTGCAGAAAAG - UNI32033 - GGGA

AGCCAAGCGTAAGGCGGGAGCAGCCTGGAGACGATACCACGGAGGCCCCCCAGAGGGAAGCAGAGGGAACGAAGGCGAAGGGAAAGGATGGTGAGCCCCC

GGGTCTTATGGAAGAGGAGGATGGTGACGACGAAGAGGAGGAGGAGGAGGAGGAAGAGGACGAGGAGGAGCAGCAGCTCCTGGGAGAGTTCGAGAAGGAG

CTGGAGGGGATGTTGCTGCCCTCAAACCGCGAGCGCCTCCGCTCTGAGGTTAAGGCTGGCATGGAGCGGGAGCTGGAGAACATCATCCAGGAG ACAGAG

AAGGAACTGGACCCAGAAGGGCTGAGGAAGGAGTCCGAGCGGGAGCAGGCAATATTGGCTCTAACATCCACTCTGGACAAACTCATCAAGAGGCTGCAGG

AGAACCAGAGTCCAGAGCTTGTGCAAAAATACAAAAAAAGGAGAGTTGTCCCCCAAAAGCCTCCCCCATCACCACACCCTACAG GCAAGATTGAGATCA

AGATTGTGCGACCCGGGGCTGAAGGTAAGGAAGAGGACACACGCTGGCTGACTGATGAGGATACAAGAAACCTTAAGGAGATTTTCTTCAATATCTTG G

TACAGGGAGCCGAAGAGGCCAATAAAGAGCGCCAGCGACAGAGTGAGCTGGAGAGCAACTACCGCCGGGTGTGGGGCTCTCCCGGTGGTGAAGACACGGG

GGACCTGGATGAATTTGACTTCTGAGACCACCCTGCCAGCCCTCTAAGGATTCCTGCATCTTCCTGACCGGCCGGCTCTGCCTCCTTACACCCCATTCTG

GGGCCTTGGAGGCAAAAGGGCAGATTGGAGCCCAGCACTGGACTTGAGGGGCCCAGCCCCAAGAGTGTATGAGGGTGTGTGGGGACCCATGAGGGTGAGG

AGCTGTTGCAGCCAGGCCTATGGGGTCCACTCCCCAAACACACCCTCCTTTGCCCCTTTAGCTTTTTCCTGTCCCCCAACTTCTTAGCACTTAACCCCAC

TCTACCCAGAGACTTGATGAGACCTTGTGAGTGGTGGTGGCAGGAACAGCAGGGCTGTGCAGGTCCCCGACCCCACCTCTCCCTATCCTACCTCCATTCC

CTGTTGCTGTTTGGGAGCTGTTGCCCCTCCCTTGGAACGCCTACTTCCTGTCTCTGCTGTCTCCCGGTACCTGTGCTTCTGAGCCCAGACTATCTCTTGT

CACTGAGGGGATGGGAGACCTTTCATATCACCTCACAAACAATCCCAGCAAAAAGGGTTGGAGATGGAGCACCCCCTTGTTCTTCAGCAATCAGGTTTCT

AAATAAAAAACTGGACCGTC
Translation
MAAEVLLSSLLGLLFLGLLLPARLTGGVGSLNLEELSEMRYGIQILPLPVMGGQ SQASDVVVVSSKYKQRYECRLPAGAIHFQREREEETPAYQGPGIP

ELLSPMRDAPCLLK TKDWWTYEFCYGRHIQQYHMED DSEIKGDVLYLGHYQSSFNWDDETAK ASKQHRLKRYHSQTYGNGSKCDLNGKPREAEVR -

 UNI1968 - FLCDEGAGISGDYIDRVDEPVSCSYVLTIRTSRLCPHPLLRPPASAAPQAILCHPALQPDEYMAYLQRQAE ESKQHEEKTTEEVQDTD

RQVWSGSKAAGAPPKKED DVSPAKEEKESELWKLQGPEEQAAAREEAQAG - UNI32033 - EQDLNHEAAADPAPSPPND - UNI32033 - DF

QNNVQVKLIRSPADLIRLIEELKAAEK - UNI32033 - GKPSVRREQPGDDTTEAPQREAEGTKAKGKDGEPPGLMEEEDGDDEEEEEEEEEDEEEQ

QLLGEFEKELEGMLLPSNRERLRSEVKAGMERELENIIQE TEKELDPEGLRKESEREQAILALTSTLDKLIKRLQENQSPELVQKYKKRRVVPQKPPPS

PHPTG GKIEIKIVRPGAEGKEEDTRWLTDEDTRNLKEIFFNIL VQGAEEANKERQRQSELESNYRRVWGSPGGEDTGDLDEFDF

For any suggestions or comments, please send an email to unitrap@crg.es