Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040463 (Mybbp1a)
Chromosomal location
Chr 11: 72254871 - 72265050 (+)
Description
MYB binding protein (P160) 1a Gene [Source:MGI (curated);Acc:Mybbp1a-001]
RefSeq_dna
NM_016776 
RefSeq_peptide
NP_058056.2 
UniGene
Mm.147946 Mm.413075 
MGI
MGI:106181 
Uniprot/SWISSPROT
Q7TPV4 
Uniprot/SPTREMBL
A0JLT5 Q3U2W2 Q3TLF6 
Human Ortholog
ENSG00000132382 (MYBBP1A)
Omim not available
UniTrap UNI38494
Vector Insertion
Chr 11: 72255078 - 72255179
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5859
Vector Insertion
Chr 11: 72259760 - 72260473
Public Clones CSH697 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 45% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10147
Vector Insertion
Chr 11: 72262677 - 72262762
Public Clones XB589 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37394
Vector Insertion
Chr 11: 72263336 - 72263494
Public Clones PST21726-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37434
Vector Insertion
Chr 11: 72263597 - 72264127
Public Clones PST21988-NR (escells) PST17847-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37379
Vector Insertion
Chr 11: 72264277 - 72264378
Public Clones PST17974-NR (escells) PST24525-NR (escells) PST24251-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 73% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000045633
Sequence
CGTGTTTGGCTCAGCATGGCGGAGATGAAGAGCCCCACGAAAGCTGAGCCTGCGACTCCCGCAGAAGCGGCGCAAAGCGACCGCCACAGCCTGCTGGAGC

ACAGCCGCGAGTTCTTGGACTTCTTCTGGGACATTGCGAAACCGGATCAGGAAACGCGGCTCCGGGCCACGGAGAAGTTGTTGGAGTACTTGCGCACAAG

GCCCAAT GATTCGGAGATGAAATATGCCCTGAAGCGCCTAATCACTGGGCTTGGGGTGGGCCGAGAAGCCGCTAGGCCCTGCTACAGCCTGGCGCTGGC

ACAG CTGTTGCAGTCTTTTGAAGACATCCCATTGTGTGACATCCTGGATCAGATACAAGAAAAATACAGCCTACAAGCCATGAACAAG GCAATGATGA

GACCTAGTCTCTTTGCAAACCTTTTTGGAGTGCTAGCCCTCTTTCAGTCAGGCCGCCTAGTGAAG GACAAAGAGGCCCTGATGAAGTCCGTGCAATTGC

TGAAGATCCTGTCCCAACACCCCAACCACTTACAGGGACAGCCAATAAAGGCTCTGGTGGACATCCTCTCTGAG GTCCCAGAGTCCATGTTCCAGGAGA

TCCTGCCAAAGGTCCTCAAGGGTAACATGAAAGTGATCCTCCGCTCTCCCAAGTACTTGGAGCTCTTCCTCCTGGCTAAGCAGAGGGTGCCGACAAAGCT

CGAGTCACTCATGGGCTCGGTTGACCTGTTCTCAGAAGACAATATTCCCAG TCTGGTGAACATCCTGAAGGTGGCCGCCAACTCTGTCAAGAAGGAGCA

CAAGCTGCCTAATGTGGCTCTGGACCTGCTCCGCCTGGCGCTCAAGGAGAGCAGATTCGAACTGTTCTGGAAGAAGGTTTTGGAGGAGGGGCTGCTGAAG

AATCCGTCCTGGACATCCAG CTACATGTGCTTCCGCCTACTGGGTGCGTCTCTGCCGCTTCTGTCAGAGGAGCAGTTGCAGTTGGTGATGCGAGGAGAC

TTGATCCGCCATTTTGGGGAGAACATGGTTATTTCTAAG CCCCAAAACCTATTTAAGATCATCCCAGAGATAAGTACATACGTGGGTACCTTCCTAGAG

GGGTGCCAGGATGACCCTAAGCGGCAGTTGACTATGATGGTGGCCTTTACAACCATCACCAATCAAGGTCTCCCTGTCATGCCTACCTTCTGGCGTGTCA

CGCGGTTTTTGAATGCTGAAGCCCTGCAGAGCTATGTGGCCTGGTTGCGGGACATGTTCCTGCAGCCTGACCTGAACTCCTTGGTTGACTTCAGCACTGC

CAACCAGAAGAGAGCTCAGGACGCCTCGTTGAATGT GCCTGAGCGAGCTGTATTCCGGCTCCGGAAGTGGATCATCCACCGCCTGGTCAGCCTTGTGGA

TCATTTGCATCTGGAGAAGGATGAAGCTGTGGTTGAGCAAATAGCCAG GTTTTGCTTGTTCCATGCCTTCTTTAAGACGAAGAAGGCTACGCCCCAGAT

CCCAGAGACGAAGCAGCACTTCTCCTTCCCTTTGGACGACCGCAACCGTGGGGTCTTTGTCAGTGCCTTCTTCAG CCTACTGCAGACGCTCAGTGTGAA

GTTCAGGCAGACACCAGACCTGGCTGAAAATGGGAAGCCTTGGACTTACCGCCTGGTTCAGTTGGCAGACATGCTGTTGAACCATAACCGCAATGTAACC

AGTGTGACATCCTTGACAACACAGCAGCGTCAGGCCTGGGACCA GATGATGAGTACTCTGAAGGAATTAGAGGCCCGCTCCTCTGAGACCAGGGCCATT

GCCTTCCAGCACCTGCTGCTTCTGGTGGGCCTCCACATCTTCAAG - UNI5859 - TCCCCTGCAGAAAGCTGTGATGTCCTAGGAGACATTCAGACT

TGCATCAAGAAAAGCATGGAGCAGAATCCCCGCCGATCACGCTCTAGAGCCAAAG CCTCCCAGGAGCCAGTATGGGTGGAGGTGATGGTGGAGATCTTG

CTGTCCTTGCTGGCTCAACCCAGCAACTTGATGCGCCAGGTGGTCCGGAGTGTATTTGGTCATATCTGTCCCCACCTTACTCCACGTTGTCTGCAGCTAA

TCCTGGCT GTGCTCAGCCCTGTGACAAACGAGGATGAGGATGACAACGTGGTGGTCACTGATGACGCTGATGAGAAGCAGCTGCAGCATGGAGAG GAC

GAAGACTCAGATAATGAGGACAATAAGAACTCAGAGAGTGACATGGACAGTGAGGATGGGGAAGAAAGTGAAGAGGAGGACCGTGACAAAGATGTGGACC

CAGGCTTCCGTCAACAGTTGATGGAAGTGTTAAAAGCTGGGAATGCATTG GGTGGAGTGGACAACGAGGAGGAGGAGGAGCTTGGGGATGAGGCCATGA

TGGCCCTGGACCAGAACCTGGCCAGCCTATTTAAAGAGCAGAAGATGCGCATCCAGGCCCGGAATGAGGAGAAAAACAAGCTACAGAAGGAGAAGAAGCT

CCGACGGGACTTCCAAATCAGG GCACTAGACCTGATCGAGGTGCTGGTGACCAAGCAGCCTGAGCACCCCCTGATCCTGGAACTACTTGAGCCACTGCT

GAACGTGATCCAGCACAGCATGCGCAGCAAAGGCTCCACCAAGCAGGAGCAGGACCTCCTGCACAAGACCGCCCGCATCTTCAT GCACCACCTGTGTCG

TGCCCGCCGCTACTGCCACGAGGTGGGGCCGTGTGCAGAGGCTCTGCATGCCCAGGTGGAGAGGCTTGTGCAGCAGGCTGGCAGCCAGGCTGATGCCTCT

GTCGCCCTATACTATTTCAATGCCTCTCTGTACCTGCTGCGAGTCCTCAAGGGCAACACCAATAAGAGGCACCAAGATGGTCATAAGTTACACGGAGCTG

ACACAGAGGACTCAGAG GACCAGGCTGCTAACTGCTTAGACTTGGACTTTGTGACCCGGGTGTATTCAGCATCACTGGAATCTCTTCTGACCAAGCGTA

ACAGCTCACTTACGGTCCCCATGTTCCTCAGCCTCTTCTCCAGATACCCA - UNI10147 - GTGATCTGTAAGAACCTGCTTCCCGTCCTGGCTCAG

CATGTGGCTGGCCCATCTCGGCCCCGCCATCAG GCCCAGGCATGCCTGATGCTCCAGAAGACTCTGTCTGCACGAGAGCTGAGAGTCTGTTTTGAGGAT

CCTGAGTGGGAGCAGCTGATTACCCAACTCTTGGGAAAGGCCACCCAG ACCCTGCAGACTCTTGGGGAGGCACAGAGCAAGGGGGAGCACCAGAAGGAG

CTATCCATCTTGGAGCTGCTGAACACTCTGTTGAGGACAGTCAATCACGAG AAGCTGTCTGTGGACCTCACTGCTCCCTTGGGCGTGCTTCAGAGCAAG

CAACAGAAGCTGCAGCAAAGCCTGCAGCAGGGGAATCACTCATCTGGCTCCAATCGCCTCTATGATCTCTACTGGCAGGCCATGAGGATGCTAGGAGTCC

A ACGTCCAAAGTCAGAAAAGAAGAATGCCAAGGATATTCCTAGTGACACCCAGAGCCCCGTCAGCACAAAGCGGAAGAAAAAGGGATTCTTGCCAGAGA

CCAAGAAGCGAAAGAAACTTAAATCTGAGGGCACCACACCAGAAAAGAATGCTGCGTCACAGCAGGATGCAGTGACAGAGGGTGCCATGCCTGCTGCCAC

TGGTAAAGACCAGCCCCCCAGCACAGGCAAGAAGAAAAGGAAGAGGGTAAAGGCCAGCACCCCATCCCAGGTGAATGGGATAACTGGGGCCAAGAGTCCA

GCTCCCAGTAACCCCACCCTAAGCCCCAGCACCCCTGCCAAGACCCCAAAACTGCAGAAGAAAAAAGAGAAGCTGTCACAGGTGAATGGAGCCACTCCTG

TGTCCCCCATAGAGCCTGAAAGCAAAAAGCATCATCAGGAGGCACTCAGCACAAAGGAGGTCATAAGAAAGTCCCCCCACCCCCAGTCTGCCCTGCCAAA

GAAAAGAGCAAGGCTGTCTCTGGTGAGCAGGAGCCCCAGCCTGTTACAGAGTGGGGTCAAGAAAAGGAGAGTGGCCAGCAGGAGAGTGCAGACACCTTGA

GTGTGTATAGTCTGTTTCCCTGCCCTAGAGACTCCTATTTTTTCACCAATATTTTAATAAACAATCCATGATGC
Translation
MAEMKSPTKAEPATPAEAAQSDRHSLLEHSREFLDFFWDIAKPDQETRLRATEKLLEYLRTRPN DSEMKYALKRLITGLGVGREAARPCYSLALAQ LL

QSFEDIPLCDILDQIQEKYSLQAMNK AMMRPSLFANLFGVLALFQSGRLVK DKEALMKSVQLLKILSQHPNHLQGQPIKALVDILSE VPESMFQEIL

PKVLKGNMKVILRSPKYLELFLLAKQRVPTKLESLMGSVDLFSEDNIPS SLVNILKVAANSVKKEHKLPNVALDLLRLALKESRFELFWKKVLEEGLLK

NPSWTSS SYMCFRLLGASLPLLSEEQLQLVMRGDLIRHFGENMVISK PQNLFKIIPEISTYVGTFLEGCQDDPKRQLTMMVAFTTITNQGLPVMPTFW

RVTRFLNAEALQSYVAWLRDMFLQPDLNSLVDFSTANQKRAQDASLNV VPERAVFRLRKWIIHRLVSLVDHLHLEKDEAVVEQIAR RFCLFHAFFKTK

KATPQIPETKQHFSFPLDDRNRGVFVSAFFS SLLQTLSVKFRQTPDLAENGKPWTYRLVQLADMLLNHNRNVTSVTSLTTQQRQAWDQ QMMSTLKELE

ARSSETRAIAFQHLLLLVGLHIFK - UNI5859 - SPAESCDVLGDIQTCIKKSMEQNPRRSRSRAKA ASQEPVWVEVMVEILLSLLAQPSNLMRQV

VRSVFGHICPHLTPRCLQLILA VLSPVTNEDEDDNVVVTDDADEKQLQHGE DEDSDNEDNKNSESDMDSEDGEESEEEDRDKDVDPGFRQQLMEVLKA

GNAL GGVDNEEEEELGDEAMMALDQNLASLFKEQKMRIQARNEEKNKLQKEKKLRRDFQIR ALDLIEVLVTKQPEHPLILELLEPLLNVIQHSMRSKG

STKQEQDLLHKTARIFM MHHLCRARRYCHEVGPCAEALHAQVERLVQQAGSQADASVALYYFNASLYLLRVLKGNTNKRHQDGHKLHGADTEDSE DQA

ANCLDLDFVTRVYSASLESLLTKRNSSLTVPMFLSLFSRYP - UNI10147 - VICKNLLPVLAQHVAGPSRPRHQ AQACLMLQKTLSARELRVCFE

DPEWEQLITQLLGKATQ TLQTLGEAQSKGEHQKELSILELLNTLLRTVNHE KLSVDLTAPLGVLQSKQQKLQQSLQQGNHSSGSNRLYDLYWQAMRML

GVQ QRPKSEKKNAKDIPSDTQSPVSTKRKKKGFLPETKKRKKLKSEGTTPEKNAASQQDAVTEGAMPAATGKDQPPSTGKKKRKRVKASTPSQVNGITG

AKSPAPSNPTLSPSTPAKTPKLQKKKEKLSQVNGATPVSPIEPESKKHHQEALSTKEVIRKSPHPQSALPKKRARLSLVSRSPSLLQSGVKKRRVASRRV

QTP
Transcript ENSMUST00000100899
Sequence
CGTGTTTGGCTCAGCATGGCGGAGATGAAGAGCCCCACGAAAGCTGAGCCTGCGACTCCCGCAGAAGCGGCGCAAAGCGACCGCCACAGCCTGCTGGAGC

ACAGCCGCGAGTTCTTGGACTTCTTCTGGGACATTGCGAAACCGGATCAGGAAACGCGGCTCCGGGCCACGGAGAAGTTGTTGGAGTACTTGCGCACAAG

GCCCAAT GATTCGGAGATGAAATATGCCCTGAAGCGCCTAATCACTGGGCTTGGGGTGGGCCGAGAAGCCGCTAGGCCCTGCTACAGCCTGGCGCTGGC

ACAG CTGTTGCAGTCTTTTGAAGACATCCCATTGTGTGACATCCTGGATCAGATACAAGAAAAATACAGCCTACAAGCCATGAACAAG GCAATGATGA

GACCTAGTCTCTTTGCAAACCTTTTTGGAGTGCTAGCCCTCTTTCAGTCAGGCCGCCTAGTGAAG GACAAAGAGGCCCTGATGAAGTCCGTGCAATTGC

TGAAGATCCTGTCCCAACACCCCAACCACTTACAGGGACAGCCAATAAAGGCTCTGGTGGACATCCTCTCTGAG GTCCCAGAGTCCATGTTCCAGGAGA

TCCTGCCAAAGGTCCTCAAGGGTAACATGAAAGTGATCCTCCGCTCTCCCAAGTACTTGGAGCTCTTCCTCCTGGCTAAGCAGAGGGTGCCGACAAAGCT

CGAGTCACTCATGGGCTCGGTTGACCTGTTCTCAGAAGACAATATTCCCAG TCTGGTGAACATCCTGAAGGTGGCCGCCAACTCTGTCAAGAAGGAGCA

CAAGCTGCCTAATGTGGCTCTGGACCTGCTCCGCCTGGCGCTCAAGGAGAGCAGATTCGAACTGTTCTGGAAGAAGGTTTTGGAGGAGGGGCTGCTGAAG

AATCCGTCCTGGACATCCAG CTACATGTGCTTCCGCCTACTGGGTGCGTCTCTGCCGCTTCTGTCAGAGGAGCAGTTGCAGTTGGTGATGCGAGGAGAC

TTGATCCGCCATTTTGGGGAGAACATGGTTATTTCTAAG CCCCAAAACCTATTTAAGATCATCCCAGAGATAAGTACATACGTGGGTACCTTCCTAGAG

GGGTGCCAGGATGACCCTAAGCGGCAGTTGACTATGATGGTGGCCTTTACAACCATCACCAATCAAGGTCTCCCTGTCATGCCTACCTT - UNI5859 

- CCTCTTCTCCAGATACCCA - UNI10147 - GTGATCTGTAAGAACCTGCTTCCCGTCCTGGCTCAGCATGTGGCTGGCCCATCTCGGCCCCGCCA

TCAG GCCCAGGCATGCCTGATGCTCCAGAAGACTCTGTCTGCACGAGAGCTGAGAGTCTGTTTTGAGGATCCTGAGTGGGAGCAGCTGATTACCCAACT

CTTGGGAAAGGCCACCCAG ACCCTGCAGACTCTTGGGGAGGCACAGAGCAAGGGGGAGCACCAGAAGGAGCTATCCATCTTGGAGCTGCTGAACACTCT

GTTGAGGACAGTCAATCACGAG AAGCTGTCTGTGGACCTCACTGCTCCCTTGGGCGTGCTTCAGAGCAAGCAACAGAAGCTGCAGCAAAGCCTGCAGCA

GGGGAATCACTCATCTGGCTCCAATCGCCTCTATGATCTCTACTGGCAGGCCATGAGGATGCTAGGAGTCCA ACGTCCAAAGTCAGAAAAGAAGAATGC

CAAGGATATTCCTAGTGACACCCAGAGCCCCGTCAGCACAAAGCGGAAGAAAAAGGGATTCTTGCCAGAGACCAAGAAGCGAAAGAAACTTAAATCTGAG

GGCACCACACCAGAAAAGAATGCTGCGTCACAGCAGGATGCAGTGACAGAGGGTGCCATGCCTGCTGCCACTGGTAAAGACCAGCCCCCCAGCACAGGCA

AGAAGAAAAGGAAGAGGGTAAAGGCCAGCACCCCATCCCAGGTGAATGGGATAACTGGGGCCAAGAGTCCAGCTCCCAGTAACCCCACCCTAAGCCCCAG

CACCCCTGCCAAGACCCCAAAACTGCAGAAGAAAAAAGAGAAGCTGTCACAGGTGAATGGAGCCACTCCTGTGTCCCCCATAGAGCCTGAAAGCAAAAAG

CATCATCAGGAGGCACTCAGCACAAAGGAGGTCATAAGAAAGTCCCCCCACCCCCAGTCTGCCCTGCCAAAGAAAAGAGCAAGGCTGTCTCTGGTGAGCA

GGAGCCCCAGCCTGTTACAGAGTGGGGTCAAGAAAAGGAGAGTGGCCAGCAGGAGAGTGCAGACACCTTGAGTGTGTATAGTCTGTTTCCCTGCCCTAGA

GACTCCTATTTTTTCACCAATATTTTAATAAACAATCCATGATGC
Translation
MAEMKSPTKAEPATPAEAAQSDRHSLLEHSREFLDFFWDIAKPDQETRLRATEKLLEYLRTRPN DSEMKYALKRLITGLGVGREAARPCYSLALAQ LL

QSFEDIPLCDILDQIQEKYSLQAMNK AMMRPSLFANLFGVLALFQSGRLVK DKEALMKSVQLLKILSQHPNHLQGQPIKALVDILSE VPESMFQEIL

PKVLKGNMKVILRSPKYLELFLLAKQRVPTKLESLMGSVDLFSEDNIPS SLVNILKVAANSVKKEHKLPNVALDLLRLALKESRFELFWKKVLEEGLLK

NPSWTSS SYMCFRLLGASLPLLSEEQLQLVMRGDLIRHFGENMVISK PQNLFKIIPEISTYVGTFLEGCQDDPKRQLTMMVAFTTITNQGLPVMPTF 

- UNI5859 - FLFSRYP - UNI10147 - VICKNLLPVLAQHVAGPSRPRHQ AQACLMLQKTLSARELRVCFEDPEWEQLITQLLGKATQ TLQT

LGEAQSKGEHQKELSILELLNTLLRTVNHE KLSVDLTAPLGVLQSKQQKLQQSLQQGNHSSGSNRLYDLYWQAMRMLGVQ QRPKSEKKNAKDIPSDTQ

SPVSTKRKKKGFLPETKKRKKLKSEGTTPEKNAASQQDAVTEGAMPAATGKDQPPSTGKKKRKRVKASTPSQVNGITGAKSPAPSNPTLSPSTPAKTPKL

QKKKEKLSQVNGATPVSPIEPESKKHHQEALSTKEVIRKSPHPQSALPKKRARLSLVSRSPSLLQSGVKKRRVASRRVQTP

For any suggestions or comments, please send an email to unitrap@crg.es