Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040473 (A330021E22Rik)
Chromosomal location
Chr 5: 5579282 - 5664181 (-)
Description
RIKEN cDNA A330021E22 gene Gene [Source:MGI Symbol;Acc:MGI:2443778]
RefSeq_dna
NM_172447 
RefSeq_peptide
NP_766035.1 
UniGene
Mm.319007 Mm.403905 
MGI
MGI:2443778 
Uniprot/SWISSPROT
Q8BH53 
Human Ortholog
ENSG00000105792 (C7orf63)
Omim not available
UniTrap UNI34364
Vector Insertion
Chr 5: 5626008 - 5640228
Public Clones IST13279G7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31805
Vector Insertion
Chr 5: 5604273 - 5613851
Public Clones IST14869D1 (tigm) IST14522F10 (tigm) IST11512A4 (tigm) IST13719B10 (tigm)
IST14623D10 (tigm) IST13533C5 (tigm) IST13191F11 (tigm) IST14601E9 (tigm)
IST12482F10 (tigm) IST11430B3 (tigm) IST10886H6 (tigm) IST11430D8 (tigm)
IST11640B4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000061008
Sequence
GCAGTTGGATGTCCGCTATGTTGCTGCGGCGGGGGTTACGACAGAACTTTCGGGGTCTTTCTCCTCCCTAGCTCAGCAGCGTGTTTTCTGCCAGGGCTCG

TGGGTCCGTGGCTGCGGACGCACCTAAGACCTCAGGCTCCCACCCCGAACCATGTCCACCGCGGAGGCCTCGGCCACCACGGCCGACGCCGCCGAGGCGG

GCGGCAGGACGAAGACCGGCAGTCCCCGCACAATCCCGGTGTTTGGGGTGGCGATCCCGGATGGGGAGATGCAG GGTATTTTCAAGCCTATGGACCTTA

ATCGTATCATCAAAGTCCTTGAAGAGGAGGATAAG GATGTCTCAGAAGAAAAACAACTTAATTATATCAAGAAACTGATACACTGCTATCAGAATGGAT

TT CCTCTAAGAGATTTGGCACAGATATTTAAAATTCTGAGTCTGTGTGCAGAAAAAATTGAAAAGCAGCCCTGTTTTGTAGAACCTGCATCTGACATCA

TAAAATTATGTGG CTTGCCATTTTTGAAAAAGAAAGTATCGGATGAAATAACTTACACTGAAGATACTGCTAATTCATTTGCACTTCTGG - UNI343

64 - GTGAGTTAATGAAAATACCAAGTTCTGCATTAAGGATACAAATTTGTAAATGTATTGTTGACTTCTATCATGCAGAACCATTAAAGAAACATATT

CCAG - UNI34364 - GCTACCAGCAGGTGAGTTCATCCTACAAGATTAAAATGGTAGAGGTCGGTGGCTTGGCGAAGGCAATGGTCCAGTCGGCACT

CCTGCTTGAGAATCAGCTTGTCGAGAAACTCTGGGTTCTGAAAGTCCTGCAGCATCTCTCTACTTCTG - UNI34364 - GAGTTAATTGCACTTTAA

TGGTGAAAGCCCAAGCAGCCAGCGGAATCTGTGCTCACCTCAATGACCCAGATCCCTCAGGACAGCTTTTATTTCGTTCATCAGAAGTACTTTGGAATTT

ACTGGAAAAATCTTCAAAGGAGGAAATTATACAACAGCTTAGTAACTTGGAATGCCTGCT GGCTTTGAAAGAAGTATTTAAAAACCTCTTTGTGAGGGG

GCATAGTCACTATGAGCGTCAGCTTAGAAATGATATATTAGTTATCACCACAATTATAGCTCAGAACCCTGGAGCACCGATGATT CTATTAATCGATGG

CAAAGTTATTTTGGCTTTGTTTACCTATGTGAAAAAGCCTGAGAGACTCAAGATCATGGAGTGGTCTGCAGCACAGTATGAAGAACTACAACTGCATGCG

ATTGCCACCTTGTCCTCTGTGGCTCCTTTGTTAATAGAAGAGTATATGTCATGCCACGGCAATTCTCGGATCCTTGCATTTCTGGAGTGGTGTGGGCATG

AGG - UNI31805 - ATTCCTACTTCATTCATGGTAACAGTTTCCATGGTACAGGCGGCCGTGGAAACAAGTTCGCCCAGATGCGTTACACTCTACGG

CTCCTCAGAGCCATGGTTTATCTGGAAGATGAGACTGTGAACAAGGACCTTTGTGAGAGAGGGGTTATTCATCAACTGATAG - UNI31805 - AAAT

TTTTAAAACTATGATGAGCAGACCTGCTGAGAAGGAAGAGGCCATTGCCTTAGAAATCCAGTCTGACACATTACTTATTCTGTCAGGTCTTTGTGAAAAT

TATATCCAAAGGAAG - UNI31805 - GAAATGTTTGGTACTGAAGGAGTTGACATAGTTCTTCATGTAATGAAAACAGACCCCAAGAATTTACAGAG

GGGTTTAGGCTACAATGTCCTTCTTTTCAGTACGTTAGACAGCATTTG GTGCTGCATTTTGGGATGTTATGATTCTGAAGATTATTTTCTTGAAAAGGA

AGGGATTTTTCTCCTTTTGGATATACTAGCA AAAGACCTGACTGCTGCCAGCCTTTTAATTAAACTGTGG
Translation
MSTAEASATTADAAEAGGRTKTGSPRTIPVFGVAIPDGEMQ GIFKPMDLNRIIKVLEEEDK DVSEEKQLNYIKKLIHCYQNGF PLRDLAQIFKILSL

CAEKIEKQPCFVEPASDIIKLCG GLPFLKKKVSDEITYTEDTANSFALLG - UNI34364 - GELMKIPSSALRIQICKCIVDFYHAEPLKKHIPG 

- UNI34364 - GYQQVSSSYKIKMVEVGGLAKAMVQSALLLENQLVEKLWVLKVLQHLSTSG - UNI34364 - GVNCTLMVKAQAASGICAHLND

PDPSGQLLFRSSEVLWNLLEKSSKEEIIQQLSNLECLL LALKEVFKNLFVRGHSHYERQLRNDILVITTIIAQNPGAPMI LLIDGKVILALFTYVKKP

ERLKIMEWSAAQYEELQLHAIATLSSVAPLLIEEYMSCHGNSRILAFLEWCGHED - UNI31805 - DSYFIHGNSFHGTGGRGNKFAQMRYTLRLLR

AMVYLEDETVNKDLCERGVIHQLIE - UNI31805 - EIFKTMMSRPAEKEEAIALEIQSDTLLILSGLCENYIQRK - UNI31805 - EMFGTEG

VDIVLHVMKTDPKNLQRGLGYNVLLFSTLDSIW WCCILGCYDSEDYFLEKEGIFLLLDILA KDLTAASLLIKLW
Transcript ENSMUST00000054865
Sequence
GCAGTTGGATGTCCGCTATGTTGCTGCGGCGGGGGTTACGACAGAACTTTCGGGGTCTTTCTCCTCCCTAGCTCAGCAGCGTGTTTTCTGCCAGGGCTCG

TGGGTCCGTGGCTGCGGACGCACCTAAGACCTCAGGCTCCCACCCCGAACCATGTCCACCGCGGAGGCCTCGGCCACCACGGCCGACGCCGCCGAGGCGG

GCGGCAGGACGAAGACCGGCAGTCCCCGCACAATCCCGGTGTTTGGGGTGGCGATCCCGGATGGGGAGATGCAG GGTATTTTCAAGCCTATGGACCTTA

ATCGTATCATCAAAGTCCTTGAAGAGGAGGATAAG GATGTCTCAGAAGAAAAACAACTTAATTATATCAAGAAACTGATACACTGCTATCAGAATGGAT

TT CCTCTAAGAGATTTGGCACAGATATTTAAAATTCTGAGTCTGTGTGCAGAAAAAATTGAAAAGCAGCCCTGTTTTGTAGAACCTGCATCTGACATCA

TAAAATTATGTGG CTTGCCATTTTTGAAAAAGAAAGTATCGGATGAAATAACTTACACTGAAGATACTGCTAATTCATTTGCACTTCTGG - UNI343

64 - GTGAGTTAATGAAAATACCAAGTTCTGCATTAAGGATACAAATTTGTAAATGTATTGTTGACTTCTATCATGCAGAACCATTAAAGAAACATATT

CCAG - UNI34364 - GCTACCAGCAGGTGAGTTCATCCTACAAGATTAAAATGGTAGAGGTCGGTGGCTTGGCGAAGGCAATGGTCCAGTCGGCACT

CCTGCTTGAGAATCAGCTTGTCGAGAAACTCTGGGTTCTGAAAGTCCTGCAGCATCTCTCTACTTCTG - UNI34364 - GAGTTAATTGCACTTTAA

TGGTGAAAGCCCAAGCAGCCAGCGGAATCTGTGCTCACCTCAATGACCCAGATCCCTCAGGACAGCTTTTATTTCGTTCATCAGAAGTACTTTGGAATTT

ACTGGAAAAATCTTCAAAGGAGGAAATTATACAACAGCTTAGTAACTTGGAATGCCTGCT GGCTTTGAAAGAAGTATTTAAAAACCTCTTTGTGAGGGG

GCATAGTCACTATGAGCGTCAGCTTAGAAATGATATATTAGTTATCACCACAATTATAGCTCAGAACCCTGGAGCACCGATGATT GAATGTGGCTTTAC

CAGGGATTTGATACTATTTGCAACTTTTAATGAAG TTAAAAGTCAAAACCCCTTGGTAAAAAGTCTTAAGCTTTTTAATTGCTATGAAGATTTTGAGCT

GAAGAAATTGTTATTCAATATAATTGTGATCTTATGTAAAGATTTAGCTACTGTACAG CTATTAATCGATGGCAAAGTTATTTTGGCTTTGTTTACCTA

TGTGAAAAAGCCTGAGAGACTCAAGATCATGGAGTGGTCTGCAGCACAGTATGAAGAACTACAACTGCATGCGATTGCCACCTTGTCCTCTGTGGCTCCT

TTGTTAATAGAAGAGTATATGTCATGCCACGGCAATTCTCGGATCCTTGCATTTCTGGAGTGGTGTGGGCATGAGG - UNI31805 - ATTCCTACTT

CATTCATGGTAACAGTTTCCATGGTACAGGCGGCCGTGGAAACAAGTTCGCCCAGATGCGTTACACTCTACGGCTCCTCAGAGCCATGGTTTATCTGGAA

GATGAGACTGTGAACAAGGACCTTTGTGAGAGAGGGGTTATTCATCAACTGATAG - UNI31805 - AAATTTTTAAAACTATGATGAGCAGACCTGC

TGAGAAGGAAGAGGCCATTGCCTTAGAAATCCAGTCTGACACATTACTTATTCTGTCAGGTCTTTGTGAAAATTATATCCAAAGGAAG - UNI31805 

- GAAATGTTTGGTACTGAAGGAGTTGACATAGTTCTTCATGTAATGAAAACAGACCCCAAGAATTTACAGAGGGGTTTAGGCTACAATGTCCTTCTTTT

CAGTACGTTAGACAGCATTTG GTGCTGCATTTTGGGATGTTATGATTCTGAAGATTATTTTCTTGAAAAGGAAGGGATTTTTCTCCTTTTGGATATACT

AGCA TTGAACCAAAAAAAATTCTGTAATCTGATTCTTGGAATAATGGTTGAATTTTGTGATAATCCCAAAACTTCTGCTCATGTCAATGCTTGGCGTGG

GAAGAAAGACCTGACTGCTGCCAGCCTTTTAATTAAACTGTGGAGAAAAGAGGAAAAGGAGCTAGGAGTAAAACGTGACAGGAACGGCAAGATTGTTG A

TACAAAGAGACCTCTATTTACTAGTTTTCAAGAAGAACAAAAGACCATGCCCCTTCCTGCTAACTGCCCATCTATTGCAGTTATGGATGTTGCTGAAAAT

ATCAGAGCAAAAATTTATGCTGTGTTGGATAAACTAG ATTTTGAAAACTTACCGGGCTTATCTGCCGAAGATTTTGTCACCCTCTGTATAATACATAGA

TACTTTGATTTTAAA ATTGGAGAAATATGGAATGAAGTATCTGAAGAAATAAAGCTGGAAAAGCTAAGACTAGTCACAACAGATGAAAAATCTTTGAAC

TCCATTATAGCAGCAACAGAAAATATTGGAAAGATGGTTGCGTCCTTGCAAAGTGAGATGATTGAAAACCAAGCCCTTCAGGATGTGCAGAATGAACAAA

GAGTGTATGCAAAA ATACAAGCTACACATAAGCAGAGAGAGCAGGCTAACAAGTCATGGGAAAACTTCTTGGCTAGGACATCAAATGCTAAAACATTAA

AG AAAGCAAAGAAGCTTCAAGAAAAGGCTATAGAATCCTCCAGATATACTGAACGACCACAGAATGCAACATTCCACCAAACAGTTATTAAAGGTCTTA

ACACAACG GTGCCTTCGGGTCGGGTGGTGACAGTGCAAAGCACACCTACCCGGCTACTGGGAGGACCTCTGGCTGACACAGACATCGCTCTGAAAAAAC

TGCCTATTCGAGGAGGGGCCTTGCAGCGGGTGAAAGTGAAGCCACCACTGAATGATCCTAAAAAGAGCATCCCTACATGATGTGTTCCACAGCTCCTGAA

ATAAATTTTACCTGCAACGTCTTTGCTAAATGTATATTTATATACAAATGTAAGGCAAAAATTTAGAATAAATATTTTAGTTAAATACTATAAAAATTAA

AGTTAGGATAATACACTTTATTTTTATTGAAAACACCACTGTCTTTGAAAAAATTATTGATCCTTATCTGAAACAGTAAATTTCTTTAACAATTAGGACT

TTTGGCTGTACATCAGTTACTCCAAATAGTCTACCCTAAGGGACATTTCTGTGGGCTTTGTATCTCCCAGCATGAATAATTTAGACTGTGAGAACTGTTG

AGTCAAAGGGCTGAAGCTAAGTTAGGAGGCATCTCCTTCCAGCAACCCTACCTTACATTTATCCATTGGAAAAGTATAGATGTATTTTTCTCAATAATTG

TGTAGTTCCCTCTATGTGTTGGAACCCTTGATTGGCCATGGCCACATGTCCACTCTGGAGCACCTTACCTCAGAGTCATCCAGATCTGAGCACTCCTTGC

TCTTGGGAGCCATAAACAGCCCAGCGTCATCTAAAATACCTAAATGGAGCCAAGAATCAAGGTGCTATCATCAGAAGGATATATGAATACCAGAAGCAAT

AAATAAGTTGGTGAATAGATACTATTATTAAGGGCAAGTGCCAGTCACAAGCTAAAAGTAAAAATCAGATTCACATAGTTTTACTCTAAATATATAAATT

TTCAAAGTGCAGCTGGAGAGATGGCTTAGTGTTTAACAGCACTGGCTGCTCTTCCAGAGGTACCCAGGCTTAATTCCCAGCACCAACATGACAGTTCACA

ACCATCTATAACTCCAGTCCCAGAGGATGTCATCTCTCTTCTGGTCCCCGCAGGCACCAGGCACTCACATGGTGCACAGACCTATGTGCAGGCAAAACTC

CCGTAGACATAGAACAGATAAATAAAATTTTAAATTAAGTAAATAAAATTTTGAAGCTAATTCTAATGCTATTTCTTCAATGGCAAAGGAACAAGTAGTG

TGTGGGGGAGCAGATAGAAGAATGCAACATGTTCATACAAACAGCACCAAATAATGTCACATTGAAATCTCATAACACCCAAAATCCTTTGCTGTGCCCA

TAGCTAAGAGCAATGAGTCTTTATAGCACTTAGAAACTAGGAGCTTTGTCAGACTCTCGGTTCCCTGAAGGCAAGGGAGAAAACATGTCTAATTCATGAT

TATGACCAGCACCTCAGCGATGAAGTTAGTGATGAAGGATTTGTCTCTGGCAGCCTTTCCTTTGACATCTTCAAATACAGCAATGCACTGACCTCAAAGG

GAAGAATCAGCCCACAAGTGATGCTAAGCAAGGACAGCATGTTAAAGTGGTTCAAATAAATGTACTTCAAAGTAGTTATGGGCTTTTCTCAGGTTATATA

TATATGGTATAAATATAAACATTACAGAAAATTGATGATTCAGTTGAGTATCAGTTTTACACATAGGCCCAGTGTCCTGTCTCCAGATTGATTTAGACTG

ACCCCATCAGTGTCATCTGATGTCTACATATTATTCTATCCAGTAGGAAGAGAGAACACAAAATAAGGCAGGTAATTTTCTCACAGATATTTACTACGCT

GCTTAATGCAGAAACTATACACAGGGTAGACAGATCTCTAACACATTTCTCAAGCACAGTTCCAGCCATCACACAGTGAGCCAGGAAGTTCACAACCGAT

AGCCTCACAAACTGCCCTGCTTTTCTTTCTATTTCCTATAACTGCTTCTCTTGAATCCAAGTGGATATGGTGTCTAGGTTGCCCTGCCTGAGCAATGACA

GTCTACTCTTCTGTGAGTTACCAGAGACAAATTTTTAAAGCTTTAAGACTGAAATATGTACTAATCACATAAATAAAACTTGTATTTTGAAATC
Translation
MSTAEASATTADAAEAGGRTKTGSPRTIPVFGVAIPDGEMQ GIFKPMDLNRIIKVLEEEDK DVSEEKQLNYIKKLIHCYQNGF PLRDLAQIFKILSL

CAEKIEKQPCFVEPASDIIKLCG GLPFLKKKVSDEITYTEDTANSFALLG - UNI34364 - GELMKIPSSALRIQICKCIVDFYHAEPLKKHIPG 

- UNI34364 - GYQQVSSSYKIKMVEVGGLAKAMVQSALLLENQLVEKLWVLKVLQHLSTSG - UNI34364 - GVNCTLMVKAQAASGICAHLND

PDPSGQLLFRSSEVLWNLLEKSSKEEIIQQLSNLECLL LALKEVFKNLFVRGHSHYERQLRNDILVITTIIAQNPGAPMI ECGFTRDLILFATFNEV 

VKSQNPLVKSLKLFNCYEDFELKKLLFNIIVILCKDLATVQ LLIDGKVILALFTYVKKPERLKIMEWSAAQYEELQLHAIATLSSVAPLLIEEYMSCHG

NSRILAFLEWCGHED - UNI31805 - DSYFIHGNSFHGTGGRGNKFAQMRYTLRLLRAMVYLEDETVNKDLCERGVIHQLIE - UNI31805 - E

IFKTMMSRPAEKEEAIALEIQSDTLLILSGLCENYIQRK - UNI31805 - EMFGTEGVDIVLHVMKTDPKNLQRGLGYNVLLFSTLDSIW WCCILG

CYDSEDYFLEKEGIFLLLDILA LNQKKFCNLILGIMVEFCDNPKTSAHVNAWRGKKDLTAASLLIKLWRKEEKELGVKRDRNGKIVD DTKRPLFTSFQ

EEQKTMPLPANCPSIAVMDVAENIRAKIYAVLDKLD DFENLPGLSAEDFVTLCIIHRYFDFK IGEIWNEVSEEIKLEKLRLVTTDEKSLNSIIAATEN

IGKMVASLQSEMIENQALQDVQNEQRVYAK IQATHKQREQANKSWENFLARTSNAKTLK KAKKLQEKAIESSRYTERPQNATFHQTVIKGLNTT VPS

GRVVTVQSTPTRLLGGPLADTDIALKKLPIRGGALQRVKVKPPLNDPKKSIPT

For any suggestions or comments, please send an email to unitrap@crg.es