Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000040481 (Bptf)
Chromosomal location
Chr 11: 106894397 - 106993441 (-)
Description
bromodomain PHD finger transcription factor Gene [Source:MGI (curated);Acc:Bptf-002]
UniGene
Mm.412605 Mm.467837 
MGI
MGI:2444008 
Uniprot/SPTREMBL
A2A652 A2A654 Q3TMJ3 Q6P9L3 Q8C473 Q8K092 Q8VDN7 A2A655 A2A653 Q8CFX5 
Human Ortholog
ENSG00000171634 (FALZ)
Omim not available
UniTrap UNI5381
Vector Insertion
Chr 11: 106992587 - 106993442
Public Clones SYA254 (baygenomics) YHC355 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18463
Vector Insertion
Chr 11: 106972950 - 106992587
Public Clones (cmhd) CMHD-GT_460G8-3 (cmhd) IST14980E4 (tigm) IST14980F4 (tigm)
IST15055C10 (tigm) IST14923G9 (tigm) IST14811C11 (tigm)
Private Clones OST422952 (lexicon) OST280617 (lexicon) OST262127 (lexicon) OST204219 (lexicon)
OST194467 (lexicon) OST147133 (lexicon) OST43264 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6861
Vector Insertion
Chr 11: 106957240 - 106960879
Public Clones BGB561 (baygenomics)
Private Clones OST311735 (lexicon)
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3072
Vector Insertion
Chr 11: 106948212 - 106956315
Public Clones DC0254 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37107
Vector Insertion
Chr 11: 106944015 - 106948025
Public Clones CMHD-GT_534C11-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29378
Vector Insertion
Chr 11: 106939964 - 106942036
Public Clones Ayu18-44 (egtc)
Private Clones not available
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9390
Vector Insertion
Chr 11: 106928570 - 106929588
Public Clones XH203 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4570
Vector Insertion
Chr 11: 106928440 - 106928570
Public Clones AC0770 (sanger) XG023 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI319
Vector Insertion
Chr 11: 106922997 - 106923150
Public Clones GC0847 (tigem)
Private Clones not available
Severity of mutation (?) Insertion after 70% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4795
Vector Insertion
Chr 11: 106916633 - 106917185
Public Clones AS0599 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 78% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2408
Vector Insertion
Chr 11: 106908658 - 106914102
Public Clones AA0039 (sanger) AC0540 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18077
Vector Insertion
Chr 11: 106908313 - 106908658
Public Clones CMHD-GT_481H1-3 (cmhd)
Private Clones OST430804 (lexicon) OST423007 (lexicon)
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14259
Vector Insertion
Chr 11: 106904946 - 106908658
Public Clones FHCRC-GT-S21-6F1 (fhcrc)
Private Clones OST367679 (lexicon)
Severity of mutation (?) Insertion after 94% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6145
Vector Insertion
Chr 11: 106904946 - 106905140
Public Clones CSG031 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 94% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6151
Vector Insertion
Chr 11: 106903988 - 106904074
Public Clones CSG044 (baygenomics)
Private Clones OST420041 (lexicon) OST419988 (lexicon)
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20438
Vector Insertion
Chr 11: 106894396 - 106897154
Public Clones not available
Private Clones OST362759 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33645
Vector Insertion
Chr 11: 106894396 - 106901727
Public Clones IST12680B4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000106763
Sequence
GAAACAAGATGGCGGCTGCAGGCGATCCGGAGCGGGGCCCCGGCAATTCGGACTGAGCCTTCTCCCTCCACCCCGCCGCTGCCGGGCCGCGCCCCTCCCG

CCCGGACCCCGGCGCCCTCCCCTCCCCCTCGGCCCCGGCGCCCCCCGCGCCCCTCCCCCACCCCTTCCGCTCCCCCCCCACCCCCCCGCAAGCCGCGGCT

CCGACATGAGGGGCCGGCGGGGCAGGCCGCCCAAGCAGCCCGCGGCTCCTGCTGCGGAGCGCTGCGCCCCGGCCCCGCCGCCGCCGCCGCCGCCGCCACC

ACCGCCGCCGCCACCGCCGCCGCCGCCGCCGCCCGCCTCCGGACCCATAGGGGGGCTGCGCTCGCGGCACCGCGGCAGCAGTCGGGGCAGGTGGGCCGCC

GCCCAGGCTGAGGTGGCGCCCAAGACCCGGTTGAGCTCGCCCAGGGGGGGCGGCCGCAGGAAACAGCCGCCACCGCCACCGCCGGCCTCCGGCAGCAGCG

CCAGCGGCCCGGGCCGGGGGGGCCGAGGAGGCGGGGGCGGCAGGACGGGGGGCGGGGGCGGCCACCTGGCCCGGACCACCCCGGCCCGCCGCGCCGTCAA

CAAAGTGGTGTACGATGACCACGAGAGTGACGACGACGACGAGGAGGAGGACATGGTCTCGGAGGAGGACGAGGAGGAGGAGGAGGATGGCGACGCCGAG

GAGACCCAGGATTCCGAGGACGAGGAGGAAGATGACATGGAAGAAGACGACGATGACTCCGATTATCCGGAGGAGATGGAAGACGACGACGACGACGCTA

GTTACTGCACGGAAAGCAGCTTCAGGAGCCATAGTACATACAGCAGCACTCCAG - UNI5381 - - UNI18463 - GTAGGCGAAAACCAAGAGTA

CATCGGCCTCGTTCTCCAATATTAGAAGAAAAAGACATCCCACCCCTTGAATTTCCGAAGTCCTCTGAGGATTTAATGGTGCCTAATGAGCATATAATGA

ATGTCATTGCCATTTATGAGGTGGTGCGGAACTTTGGCAACGTTTTAAGGTTGTCCCCTTTTTGCTTTGAGGACTTCTGTGCGGCTCTGGTGAGCCAAGA

GCAGTGCACACTCATGGCGGAGATGCACGTGGCGCTTCTGAAAGCAGTTCTTCGAGAAGAGGACACGTCTAACACCACCTTTGGCCCTGCGGACTTGAAA

GACAGTGTAAACTCCACCCTGTATTTCATCGACGGGATGACGTGGCCGGAGGTCCTGAGGGTCTACTGTGAGAGTGACAAGGAGTACCACCATGTCCTTC

CTTACCAGGAGGCAGAGGACTATCCCTACGGACCAGTGGAGAACAAAATCAAAGTTCTGCAGTTTCTAGTCGATCAGTTCCTTACGACCAATATTGCTCG

TGAGGAGCTGATGTCTGAAGGGGTAATCCAGTATGACGACCATTGTAGGGTCTGTCACAAACTTGGGGATCTGCTGTGCTGTGAGACGTGCTCGGCTGTG

TACCATTTAGAGTGTGTGAAGCCGCCTCTTGAAGAAGTGCCGGAGGACGAGTGGCAGTGTGAAGTCTGTGTGGCACACAAGGTGCCTGGTGTGACTGACT

GTGTCGCTGAAGTCCAAAAGAATAAACCCTACGTTCGACACGAACCTATTGGGTATGACAGAAGCCGTAGGAAATACTGGTTTTTAAACCGAAGACTCAT

AAT AGAAGAAGACACAGACAATGAAAACGAGAAGAAAGTTTGGTACTACAGCACAAAGGTCCAGTTAGCAGAGCTAATAGACTGCCTAGACAAAGGATA

CTGGGAAGCAGAACTGTGCAGAGTTCTAGAAGACATTCGGGAGGAGATGCAGCAGCATATGGATGTAACGGAAGACCTGACCAACAAGGCTCGTGGCAGC

AACAAGTCCTTCCTAGCGGCAGCTAATG - UNI6861 - AGGAAATTTTGGACTCCTTAAGAATCAAACGAGGGGAAGATATTGACTGTGATCAGAGC

CCAGAAGACCCAGAAAAGGACAAGCATGAGGGCGAGAACAACAGCTCCAAGGATGCTGAGAAGAGCAGGGAGGAGGCGGAGGACCCTTCCGCAGACAAGG

ACGCTGACAGCAAAGGCCTGGAGGAAGAGCCCGGGCATGGAAAACCTGAGG AGCCAACAGAAGTTGGGGATAAAGGTAACTCTGTGCCAGCAAATCTTG

GCGACAACACAACAAATGCTTCTCCAGAAGAGACTAGTCCCTGTGACGGGAGGAGCCCCGAGGGCTGTCTCTCAGAGACCCATGATAGCAGCAGCATGGC

AGAGAAGAAGGTGGCATCTGAGCTCCCCCCGGATGTACCAG - UNI3072 - AAGACTCTAACAGGACATGTGACAGCAGTAACACTAGTGCTACCAC

TGCCTCCAGCCAGCCTAACCTGGAGACCTGCAGCAGCAGCGAGCTCACTTCTTCCCAGAGTGACTCTGCTAAGGCAGCGGATGACCCTGAGATTGGAGAA

AGAGACTCCCATACACCTGTCTCTGTTCACGAAGAGATAG GTGATTTCAGACTGGAGAAGTCCAATGGAGAAGTTTCCGAGTCCCCTGGAGCTGGGAAA

GGAACATCTGGGTCCACTCGTATCATCACCAGACTGAGGAACCCGGAGAGCAAACTCAGTCAGCTCAAGAGTCAGCAGGTGGCAGCTGCAGCCCATGAAG

CAAATAAATTGTTTAAGGAGGGGAAAGAG GTGCTGGTGGTTAACTCCCAAGGAGAGGTTTCACGGCTGAGCACCAAAAAGGAGGTGGTCATGAAAGGGA

ACATCAACAACTATTTTAAGCTGGGACAAGAAGGGAAGTATCGAGTCTACCACAATCAATACTCGACCAATTCATTTGCTCTGAATAAACACCAGCACAG

AGAAGACCATGATAAGAGGAGGCATCTTGCACATAAATTCTGTCTCACTCCAGCTGGGGAGTTCAAATGGAACGGGTCTGTTCACGGGTCCAAAGTCCTT

ACCATCTCAACCCTGAGACTCACCATCACACAGCTAGAGAGCAACATTCCTTCATCCTTCCTTCACCCCAATTGGGCTTCACACAG GGCTAATTGGATC

AAGGCCGTTCAGATGTGTAGTAAACCCAGAGAGTTTGCGTTGGCTCTCGCAATTCTGGAGTGTGCAGTTAAGCCAGTTGTGATGCTGCCAATATGGCGGG

AGTCTCTAGGACATACCCG - UNI29378 - GTTACATAGGATGACATCAATTGAAAGGGAAGAAAAAGAGAAAGTTAAAAAAAAGGAGAAAAAACAA

GAGGAGGAGGAGACAATGCAGCAGGCCACATGGGTAAAATACACATTTCCAGTGAAGCACCAG GTGACAGGGTACGGCGGCTGGAGCTGGATTAGCAAG

ACGCACGTTTACAGATTTCTTCCCAAGTTACCAGGAAACACGAATGTAAACTACAGAAAGCCCTTGGATGGAG CCAAAAACAATACAGATGAAAATAAA

GATGAGTCAGAGAAAAGGAAAAGTCCACGAAGTCCAAAAAAAATGAAGACAGAATGTGATTCTGAACAAGGTGAGACCAGAGATGCAGATGCCACAGCTG

GAGCCGCCGCAGGGGCAATGGAGCTGTCTAAGGAACCTGAGAAGAAGGATCAAG ATGTAAAAGAACTTTTAGATTCTGATAATGACAAATCCTTCAAGG

AAGAACCAATGGAGATCGATGATACCATAAAAACAGAGTCACACGTGAGCAGTCTGGAAAGCACAGAGGTAGATGTAGTCAATGTTAGTGAGGGCTTCCA

TCTAAGGACTAGTTACAAAAAGAAAACGAAATCCTCTAAGCTGGACGGGCTTCTGGAACGGAGGATTCGACAATTTACACTGGAAGAAAAACAGCGTCTT

GAGAAGTTAAAGCTGGAGAGTGGGGTGAAGGGGGCGGGGAAGCCCCCCATGGGTGCTCTGAAAAGCTCCTCTGAGTCTCCAGGCTCCACAAAAGCAAGCG

AAGGGCATCAGGGTGACTCGCTGAGACAGGAACAAAGCCCCAGTTCAAGTCAGGCTAGCACTGTGGACTTGGGGCTGGGGGGCTCACAAAGTGATCCCTT

GGTTCTTGGCATCAGTCCTCCTAGTCTAAGCACGCACAAACCTGATCCAAAAGATCAAGTATTAGATGATGTCTCCATTCAGAGTCCAGGGCCAAACTGT

CAGAGGCAAAACTCAGTTGAAAGCGACCTAGATGCCAGGATCTCTGAACCTGCCGGTAAGGGACTGGAACTAAGTCAGACTAAAACAGAAGTGACTGACT

CTTCCTCTGATGACTCTAAACCAACCAGTGCAGACGATGTTGGCATTTTGATCTGTAAGAGCAGAAAGCTGCACTCACAGGACGATAGCAGCACCGTTGT

GTCTTCTTCCAAGAGTACTTTACCTGCATCAGTACCTAAAAGTCCCCGTGACAGAGATGCCCGGGCCTTCTCAAAAGCAGTGGACTTCGATGGGAGACTA

GGTGGTGACTCTGAATATAGTAGCACTTTGGAAAATAGCTCTGATAATATGTGTATTCGGGACAGTGCTGAAGAAGATATGGTTGTTCAGAACAGCAGTG

AAGCCACCTCGAAACGGTTCATAGCTCCAGAACAAGGAGGAGAAAGCGTGGAGTCGACAAAATGTCAGGTAGTTTCTAAGTCCACTGAAAACTGTGAAGA

CAAACTACAGGGTAAGGTAACTGAAGCAAACGGTAAGAAACTGGGCCAACATCCTCCAAAGCCAGAGGAGAGAGCAGTTAACAGATGTACTGACCAAGTC

AGCCTGCGACACAGCGTTGACAGAAAGAACAGTGAACCTCGAGAGTCTGAAAAGAAAGGACAGAAAGCAAATAAATTTCAAATAAACGGCAAAGATAGCA

AAGCTAAGGGGTACCTGAAGGGGCCGGGCACGAAGGACGGCTCTGATGGTAAAGTTGTGAGTAGTGCTGTAGAACCAAAGGTCAATAATATCAATAAAGT

CATCCCTGGGAATACCAAGTCACTGGCTGGGAAGGAATCTGCTGCGAAGCCGTTCATCAACGGTGACATCATTATGGAAGAGTTGAGTGAACAAAACACT

TCAGAAACCAACTCATACTCACTGAGTTCTTCAGATGCCAAAGGTAATCACCAAGATGGCCTCCATACCCTACCATCCACCAAAGAGTCTGCCAGTACCC

AGGTAATCACACCCCGAGCCCCTTGTCCAGATCGGAACTCACTTAGTCAGGTAGAAGATATGGAAACTGAAAGTCCAGAGGTTAAGAGAGTTATCCCGTC

TCCTGTTAGAACTGGAGAGGGCTCTAACCTTAGCAAGGGCTTCATGGATGACAATGGACTGCCTTCCAGCAAAGACGAGAACGTCAATGGAGAATCCCAA

AGAAAGACGGTCATCACAGAAGTCACCACAATGACATCTACTGTTGCCACAGAATCAAAAACTGTCATTAAGGTAGCAAAAGGAGACAAGCAAACTGTGG

TTTCTTCCACAGAAAATTGTGCCAGATCCACAGTCACAACTACCACTACCACTGTGACAAAGCTCTCCACACCCTCCCCAGACACCGGTGTGGATACCAT

CTCTGTAAAGGAGCAGAGTAAAACCGTGGTCACCACGACAGTGACGGACTCCTTGACCACTGCAGGAAGCACACTGGTGACATCTATGACCGTGAGCAAA

GAGTACTCCACGAGAGACAGGGTAAAGCTGATGAAGTTCTCACGACCCAAGAAGACCCGCTCAGGCACTGCCCTGCCGTCCTATAGGAAGTTCGTTACCA

AGAGCAGCAAAAAGAGCATATTTGTGTTACCTAATGATGACTTGAAAAAGCTGGCCAGGAAAGGAGGGATCCGGGAGGTCCCTTACTTTAATTATAACGC

GAAACCTGCCTTGGATATATGGCCATACCCTTCTCCTAGACCGACCTTTGGTATCACATGGAG GTATAGACTACAGACGGTAAAGTCCTTGGCTGGAGT

GAGCCTGATGTTACGGTTGCTGTGGGCCAGTTTGAGATGGGATGACATGGCAGCCAAGGCTCCTCCAGGAGGAGGGTCTACACGGACAG - UNI4570 

- - UNI9390 - AAACATCTGAAACTGAAATCACAACCACTGAGATAATTAAGAGGCGTGATGTGGGCCCTTATGGCATTCGTTCTGAGTATTGTATC

AGGAAGATCATTTGCCCCATTGGAGTTCCAGAAGCACCAAAAG - UNI4570 - AAACACCCACACCTCAGCGGAAGGGCCTCCGATCAAGTGCACTT

CGGCCAAAGAGACCAGAGACCCCCAAGCAGACGGGCCCTGTTATCATTGAGAGCTGGGTAGCAGAAGAAGAGCTGGAGCTCTGGGAGATCAGGGCTTTTG

CTGAGAG AGTGGAGAAAGAAAAGGCTCAAGCAGCAGAGCAGCAGACCAAG AAACGTTTGGAGCAGCAGAAGCCTGCAGTCATCGCAGCGTCCACCACG

TCCCCAGCAAACAACACAAGCAGCACTGTCTCTCCAGCCCAGAAGGTGATGGTGGCTCCCTTAAGTGGCTCGGTCACCCCTGGAACAAAGATGGTGCTGG

CCACAAAAGTCGGCTCGCCTGCCACAGTCACATTCCAGCAAAACAAGAACTTCCATCAAACTTTTGCCACGTGGGTGAAGCAAGGCCAGTCCAATTCAG 

- UNI319 - GCATGGTCCAGGTACAGCAGAAGGTCCTGGGGATCATTCCATCGACTACAGGTCCAAGCCAGCAAACCTTTACTTCATTCCAGCCCAGG

ACTGCAACTGTCACAATTAGGCCCAATACCTCAGCCTCTGCAGGAACCACTACCACATCACAG - UNI319 - GTGATCACAGGGCCTCAGATCCGCC

CTGGCATGACAGTGATTAGAACGCCACTCCAGCAGCCAGCACTGGGAAAGGCGATCATTCGAACACCAGTGGTGGTGCAGCCAG GCACACCCCAACAAG

TTGTGACTCAAATCATCCGAGGACAGCCTGTTTCCACTGCCATCTCTGCTCCAAGTACAGCTTCCTCAGCACCTGTACAAAAGGGCTTAACTCCAGGAGC

AGCGGCTGGGCCTCTGCAGCCTTCAGCCCCACACAGCCCTCGTCCTCAGCAAGGGCAGGTGAAGCTCACCATGGCTCAGCTCACTCAGCTCACGCAGGGC

CAT GGCGGCAACCAAGGTTTAACAGTAGTGATTCAAGGACAAGGGCAGACTACTGGACAGTTGCAGTTGATACCTCAGGGGATGACAGTCCTTCCAGGG

CCAGGGCAGCAGCTCATGCAAGCTGCAATGCCGAATGGCACCGTTCAGCGTTTCCTCTTTACCCCACTATCAACATCAGCCACGGCCGCCAGCAGCAGCA

GCAACAGCAGCAGCACCACTACTAATGCTACAGCAGCAG - UNI4795 - GCTCAGGGGAACAAAAACAGAGTAAAATATTACCCCAGACCCAGGTAC

AACCAGCCACAACCCTGGCACCAACTCAGTCATCAAGTGTGAGTCCTGCAGAAGCCCAGCCACAGCCTGCTCAGCCTGCAGCACAACCCCAGCCCCAGCC

CCAGCCCCCAGCTCAGCCTGAAGTCCAGACCCAGCCAGCTGTCTCGTCCCATGTCCCTTCTGAAACACAGCCCTCCCAAGCACAGACATCTAAACCCCTG

GTTGCAACACAGTGTCAGCCTCAGAGCAGTGTACAAGGACAGTCTCCTGTTCGAGTCCAGAGTCCACCACTGACTCGAATACGTCCATCAACTCCATCCC

AAGTGACTCCTGGACAGCAACCCCAGGTTCAGACTACAGCTTCACAGCCGATTCCAATTCCGCCCCCCACATCTCTGCAGGCACCTTCCCAAGGCCAGCC

ACAGTCACAGCCCCAGGTACAGTCTTCAACTCAAACTCTTTCATCAGGACAGACATTAAATCAAGTTACTGTTCTATCTCCATCCTGTCCTCAGCCACAG

CCCCAAGTCATTGCTGTGCCTCAGCTCCAGCAAGTCCAGGTTCTCTCTCAGATCCAGTCGCAGGTTGTGGCTCAGATACAGGCCCAGCAAAGTGGTGTGC

CCCAGCAAATCAAACTTCAGTTGCCCATTCAAGTTCAGCAAAACAGTGCTGCGCAGACTCAGAGTGTGGTCACAGTGCAGGCAGCCAGTGTGCAGGAGCA

GTTGCAGAGGGTTCAGCAACTCAGGGACCAGCAGCAAAAGAAGAAGCAGCAGATAGAAACTGAGCGTGAACACACCCTCCAAGCTTCTAACCAAAGTGAG

ATCATTCAGAAACAG GTGGTGATGAAGCATAATGCTGTAATAGAACATTTAAAACAGAAAAAGACCATGACTCCAGCTGAAAGAGAAGAAAATCAAAG 

GATGATTGTCTGTAACCAGGTGATGAAGTATATTCTGGATAAGATAGATAAAGAAGAAAAACAGGCGGCCAAGAAACGCAAGCGGGAGGAGAGTGTGGAG

CAGAAGCGGAGCAAACAGAATGCCAGCAAGCTCTCTGCTCTGCTGTTCAAACACAAGGAGCAGCTCAAAGCTGAGATCCTGAGAAAGAGAGCGCTCCTGG

ACAAAGAGTTGCAGATCCAAGTGCAG - UNI2408 - - UNI14259 - - UNI18077 - GAAGAGCTGAAAAGAGACCTGAAAATGAAACGAGA

GAGGGAGATGGCCCAGGCGGTACAGGCCAATGCTGCCTCAGTGCCCACACCCTCCGTGCCAGCCCCTGTGCCAGCGCCTGCACCGGCAGCCCCTCCAGCT

CCTCCTCGTTCTCCGCCTCCCTCCACACACAGTCTGCCACCTGCAGGCCACCCCACAGCCCCACTGCCTGTCACTTCCCAGAAGAGGAAGCGGGAGGAAG

AGAAGGACTCTAAGTCCAAGAAGAAGAAGATGATCTCTACCACCTCTAAGGAGGCCAAGAAGGACACCAGGCTATATTGCATCTGCAAGACACCGTACGA

TGAGTCCAA - UNI6145 - - UNI14259 - - UNI18077 - ATTTTATATTGGCTGTGATCGGTGTCAGAATTGGTACCACGGGCGCTGTGTT

GGCATCTTGCAAAGTGAGGCAGATCTCATTGATGAGTATGTCTGTCCACAGTGCCAGTCGACAGAGGACGCCATGACAGTGCTCACACCACTGACAGAGA

AAGATTATGAGGGCTTGAAGAGGGTGCTGCGCTCCTTACAG - UNI6145 - - UNI6151 - - UNI14259 - GCCCACAAGATGGCGTGGCCT

TTCCTTGAACCGGTAGACCCCAATGATGCACCGGATTATTACGGTGTTATTAAAGAGCCAATGG - UNI6151 - - UNI33645 - ACCTTGCCAC

CATGGAAGAAAGAATACAAAAACGGTATTATGAAAAGCTGACAGAGTTCGTGGCAGATATGACCAAAATTTTTGATAACTGCCGTTATTACAATCCCCGT

GACACCCCTTTTTACCAGTGTGCAGAAGTTCTTGAATCATTCTTTGTACAGAAACTAAAAGGATTCAAGGCCAGCAG - UNI20438 - - UNI3364

5 - GTCTCATAACAACAAGCTGCAATCTACAGCTCCTTAGAACTCAGCGTGTCTGTCACCTAAGCTAGACACAGCAAGTCTGGCGCTCTGAACTATTTA

AACTAAAGCGCCAGATATTTTCAGTCAGGCTTTCCTGACAAGACCGTAACCTCGTTCATATTGGTCACAACAGTCCAGTTGTATTCTTGGCCAATTTTGT

CCAACGGACAAAGGAAAAGCAAAGTCAACGGCACCGTTGTCTTGTCGAGAGCAAATGGCTTTACTATTGTGGCAGAAGCAGGAAACTTTGTTTATTGGAA

AAAAAAAAAAAAAAAAGAAAAAGCAAGAAAAAAAAAAAAAGATACTATGGGGTCAAGTGTAACTCCGTGGGATGCCACATCTGCTCTTCAGTGAAGAAGC

TGTTTAGAGTCTCAGAAAACTTTTTGACTGTATTTATTTATTGTTGCAAAAAAAAGACGCTTTTTTATTGCTGCCCTCATTTGTCAGCTAATTATTTTTT

CTTATACAAATCCAGCCCTGGTTCCGTGTATCCACCCTGTATCCTATCATGATTCCTGTAGGTGAAGTACAAGGCGACCTCTAGGTGTCTTTTCTTTCTA

TGAAAGGAGCTGCTATGTACACATGTGCACACACAACTGGGAATCAACAATGAGTTTATTGTTCACGGGAGACACAAGTGAAGCTTGCGGAAAGGTTGGG

CTAAGTGGTCCTGGACTAACAGACTTCGTTGCCTTGAATACACCAGTACAAATTGTCATTTACTCTGCACCAGGCTAAATGAGCAAAATCTATTTGAAGG

TATCTTGTTTGTAAACATTGTCAGATTCTAATTTTTTTCTTTTTGTATTAAAATTCAACTATGGATGTATACGAATCGAAATAAATGGAGATCATTTTTC

TCCCACAGATGGAGGTCTCTTTGAATGTGCGCTGTGATTACCTGTAAGCCTTTGTGGGGGACGGGGCGGGGGAGAGACCAGGAATGACAGGAAGACCTGG

ATTTCTCTAGAATAGCAGAGGCCCTTCCTTTCCTAAGTCCCTTCTCACCACATCAGAGAAAATCTCCAGGGAGCCGGTCCCTTGCATCTCTTGGTCATCC

CTGTAATAACGGGAATATGACACAGTACAAGCTGCCTTCATCCCCGCCTTCCAAAACTGTAGACAGATTCCTGTGTGGGATGAAGGGTGTTTGCTGGCCG

GGTTCCTTGGGTTTTGTTTGTTGCAGTAGAGCAGGGTAGAGGGTAGAGCAGACAGGCTCGCCCTGCATCTTCCTCCTGCGGGTGCTCTCACCCTCCCTCC

CCTTGGAGCTGCTTGCTGTGTTGTGAAAACCAGCCAGGATTGAGTCAGGCTGCCTCGCAGATGTTTTCCTAGATTTGCACTAGTCCATGTTAGCCCTGTC

CTGCTGGGTTCTAGAATCTACCTAGTTTTTGTTTTTTAAAAGCCGCCTCTGTGCATTTGGTGTCGCCCTGCTATGCAAAGCCTTCCCCAGCCCTTAGTTT

CTTGAAAGGAAACTGTGGCAGCAGTTGGCAAATTCTTCCTTATGACAGGCTCAGGTGTACAGGTTCTTCTGGGTCACGTGCTCTATGGAAGCCTACTCCC

TCTGTACATAAAAATGTCACTTTAGCCTGTGCTTACAGCTAAAGAGACTTAACTGCTCAATATGATAGCAAAGTTTTTGCTTAAACTATTAAGGTGGAAG

TAGTTAAATACAGGCTATTTTGTTCTTTTAGTTTACAAAAAAGAAAAAAGAAAAAAAATGTTCCACGTTGTAGGCACTGTGCTGATGCAAGAATTCTACA

TCCTAATAATACAAAGTGATTCTGCATCTGCCCACGTCCAGTATTCCTGTACTATCTATTCATATATCTAAGCATATATGGGCTTAATCACTTAAGCTTG

TTGCAGCAAAAGCTTTCCTACCTGTAGGCAATAGATTGCTATGTTTTTAACAAATTGTAGCAAATTCTAAATAATCCTTTTTGTACGTAATAGGACATTT

CATCCTAAAAAATAAAGTAATGTTTTTGACATTGGATTCTGTGCAGTTTCTAATGAGACAATGACTGGTTGGGTCAATGTTTGCTATATTTTTCTGAAGC

TGTTGGCATTGCCAAGTTGTACAGAAATGGGGGTGGGTATGGGTTGTGGATTTCTGAGACCAGGAAGATGTTAATTTCTTATTTGTGTACTTAATGATAT

AAAGACTTTTGCAGTTTCTATCACCATGTAAAGACATTTTATAGTTTTATCAGACTGTGGAGTTTTAGTCTTTCAACGTACATTTATTTCAAAAGCTGCT

TTTCTACAGATCTCATTTGACCTTCTTCTACTCCTCAATAAAAGTGTTAGGCTGTCTGCTCCGTCCGGCAGACCAAGTGGTCCGATATGCGATATGGGTA

GGACTCAGGTTCTGTGCCTAGAAGTTGTATTTCTTTGCTTTGATAGATTTCTTTGGCTAAAAGTATTTTTTAGCATTTCCTGTGTTCATCTCCAGATTCA

CAGTTTAAGACCATTTCTTAAGAGATATTTTCATAACGGCGGTAAGGCTTTTTTCTCCTGTGCAGGTTCTTCAGGGCTTGTATTTACTGTCCTGTGCTAG

GTCAAAGAAATTGCGAACTTTTGGAGATGTTTTCTACAGTAAAAAAATGACCTTTTTCTATTTGGAGTGGCCTGGAGTGCTGTGTGGGACCCTCCCAATG

TGCTGCTGTCTGTAACCTGTCCTCTTAAGAGCTGCAAATAAAACTTCTCTCCCTGTCTCCG
Translation
MRGRRGRPPKQPAAPAAERCAPAPPPPPPPPPPPPPPPPPPPPASGPIGGLRSRHRGSSRGRWAAAQAEVAPKTRLSSPRGGGRRKQPPPPPPASGSSAS

GPGRGGRGGGGGRTGGGGGHLARTTPARRAVNKVVYDDHESDDDDEEEDMVSEEDEEEEEDGDAEETQDSEDEEEDDMEEDDDDSDYPEEMEDDDDDASY

CTESSFRSHSTYSSTPG - UNI5381 - - UNI18463 - GRRKPRVHRPRSPILEEKDIPPLEFPKSSEDLMVPNEHIMNVIAIYEVVRNFGNVLR

LSPFCFEDFCAALVSQEQCTLMAEMHVALLKAVLREEDTSNTTFGPADLKDSVNSTLYFIDGMTWPEVLRVYCESDKEYHHVLPYQEAEDYPYGPVENKI

KVLQFLVDQFLTTNIAREELMSEGVIQYDDHCRVCHKLGDLLCCETCSAVYHLECVKPPLEEVPEDEWQCEVCVAHKVPGVTDCVAEVQKNKPYVRHEPI

GYDRSRRKYWFLNRRLII IEEDTDNENEKKVWYYSTKVQLAELIDCLDKGYWEAELCRVLEDIREEMQQHMDVTEDLTNKARGSNKSFLAAANE - UN

I6861 - EEILDSLRIKRGEDIDCDQSPEDPEKDKHEGENNSSKDAEKSREEAEDPSADKDADSKGLEEEPGHGKPEE EPTEVGDKGNSVPANLGDNT

TNASPEETSPCDGRSPEGCLSETHDSSSMAEKKVASELPPDVPE - UNI3072 - EDSNRTCDSSNTSATTASSQPNLETCSSSELTSSQSDSAKAAD

DPEIGERDSHTPVSVHEEIG GDFRLEKSNGEVSESPGAGKGTSGSTRIITRLRNPESKLSQLKSQQVAAAAHEANKLFKEGKE VLVVNSQGEVSRLST

KKEVVMKGNINNYFKLGQEGKYRVYHNQYSTNSFALNKHQHREDHDKRRHLAHKFCLTPAGEFKWNGSVHGSKVLTISTLRLTITQLESNIPSSFLHPNW

ASHR RANWIKAVQMCSKPREFALALAILECAVKPVVMLPIWRESLGHTR - UNI29378 - RLHRMTSIEREEKEKVKKKEKKQEEEETMQQATWVK

YTFPVKHQ VTGYGGWSWISKTHVYRFLPKLPGNTNVNYRKPLDGA AKNNTDENKDESEKRKSPRSPKKMKTECDSEQGETRDADATAGAAAGAMELSK

EPEKKDQD DVKELLDSDNDKSFKEEPMEIDDTIKTESHVSSLESTEVDVVNVSEGFHLRTSYKKKTKSSKLDGLLERRIRQFTLEEKQRLEKLKLESGV

KGAGKPPMGALKSSSESPGSTKASEGHQGDSLRQEQSPSSSQASTVDLGLGGSQSDPLVLGISPPSLSTHKPDPKDQVLDDVSIQSPGPNCQRQNSVESD

LDARISEPAGKGLELSQTKTEVTDSSSDDSKPTSADDVGILICKSRKLHSQDDSSTVVSSSKSTLPASVPKSPRDRDARAFSKAVDFDGRLGGDSEYSST

LENSSDNMCIRDSAEEDMVVQNSSEATSKRFIAPEQGGESVESTKCQVVSKSTENCEDKLQGKVTEANGKKLGQHPPKPEERAVNRCTDQVSLRHSVDRK

NSEPRESEKKGQKANKFQINGKDSKAKGYLKGPGTKDGSDGKVVSSAVEPKVNNINKVIPGNTKSLAGKESAAKPFINGDIIMEELSEQNTSETNSYSLS

SSDAKGNHQDGLHTLPSTKESASTQVITPRAPCPDRNSLSQVEDMETESPEVKRVIPSPVRTGEGSNLSKGFMDDNGLPSSKDENVNGESQRKTVITEVT

TMTSTVATESKTVIKVAKGDKQTVVSSTENCARSTVTTTTTTVTKLSTPSPDTGVDTISVKEQSKTVVTTTVTDSLTTAGSTLVTSMTVSKEYSTRDRVK

LMKFSRPKKTRSGTALPSYRKFVTKSSKKSIFVLPNDDLKKLARKGGIREVPYFNYNAKPALDIWPYPSPRPTFGITWR RYRLQTVKSLAGVSLMLRLL

WASLRWDDMAAKAPPGGGSTRTE - UNI4570 - - UNI9390 - ETSETEITTTEIIKRRDVGPYGIRSEYCIRKIICPIGVPEAPKE - UNI45

70 - ETPTPQRKGLRSSALRPKRPETPKQTGPVIIESWVAEEELELWEIRAFAER RVEKEKAQAAEQQTK KRLEQQKPAVIAASTTSPANNTSSTVS

PAQKVMVAPLSGSVTPGTKMVLATKVGSPATVTFQQNKNFHQTFATWVKQGQSNSG - UNI319 - GMVQVQQKVLGIIPSTTGPSQQTFTSFQPRTA

TVTIRPNTSASAGTTTTSQ - UNI319 - VITGPQIRPGMTVIRTPLQQPALGKAIIRTPVVVQPG GTPQQVVTQIIRGQPVSTAISAPSTASSAPV

QKGLTPGAAAGPLQPSAPHSPRPQQGQVKLTMAQLTQLTQGH GGNQGLTVVIQGQGQTTGQLQLIPQGMTVLPGPGQQLMQAAMPNGTVQRFLFTPLST

SATAASSSSNSSSTTTNATAAG - UNI4795 - GSGEQKQSKILPQTQVQPATTLAPTQSSSVSPAEAQPQPAQPAAQPQPQPQPPAQPEVQTQPAVS

SHVPSETQPSQAQTSKPLVATQCQPQSSVQGQSPVRVQSPPLTRIRPSTPSQVTPGQQPQVQTTASQPIPIPPPTSLQAPSQGQPQSQPQVQSSTQTLSS

GQTLNQVTVLSPSCPQPQPQVIAVPQLQQVQVLSQIQSQVVAQIQAQQSGVPQQIKLQLPIQVQQNSAAQTQSVVTVQAASVQEQLQRVQQLRDQQQKKK

QQIETEREHTLQASNQSEIIQKQ VVMKHNAVIEHLKQKKTMTPAEREENQR RMIVCNQVMKYILDKIDKEEKQAAKKRKREESVEQKRSKQNASKLSA

LLFKHKEQLKAEILRKRALLDKELQIQVQ - UNI2408 - - UNI14259 - - UNI18077 - EELKRDLKMKREREMAQAVQANAASVPTPSVP

APVPAPAPAAPPAPPRSPPPSTHSLPPAGHPTAPLPVTSQKRKREEEKDSKSKKKKMISTTSKEAKKDTRLYCICKTPYDESK - UNI6145 - - UN

I14259 - - UNI18077 - KFYIGCDRCQNWYHGRCVGILQSEADLIDEYVCPQCQSTEDAMTVLTPLTEKDYEGLKRVLRSLQ - UNI6145 - 

- UNI6151 - - UNI14259 - AHKMAWPFLEPVDPNDAPDYYGVIKEPMD - UNI6151 - - UNI33645 - DLATMEERIQKRYYEKLTEF

VADMTKIFDNCRYYNPRDTPFYQCAEVLESFFVQKLKGFKASR - UNI20438 - - UNI33645 - RSHNNKLQSTAP
Transcript ENSMUST00000106762
Sequence
GAAACAAGATGGCGGCTGCAGGCGATCCGGAGCGGGGCCCCGGCAATTCGGACTGAGCCTTCTCCCTCCACCCCGCCGCTGCCGGGCCGCGCCCCTCCCG

CCCGGACCCCGGCGCCCTCCCCTCCCCCTCGGCCCCGGCGCCCCCCGCGCCCCTCCCCCACCCCTTCCGCTCCCCCCCCACCCCCCCGCAAGCCGCGGCT

CCGACATGAGGGGCCGGCGGGGCAGGCCGCCCAAGCAGCCCGCGGCTCCTGCTGCGGAGCGCTGCGCCCCGGCCCCGCCGCCGCCGCCGCCGCCGCCACC

ACCGCCGCCGCCACCGCCGCCGCCGCCGCCGCCCGCCTCCGGACCCATAGGGGGGCTGCGCTCGCGGCACCGCGGCAGCAGTCGGGGCAGGTGGGCCGCC

GCCCAGGCTGAGGTGGCGCCCAAGACCCGGTTGAGCTCGCCCAGGGGGGGCGGCCGCAGGAAACAGCCGCCACCGCCACCGCCGGCCTCCGGCAGCAGCG

CCAGCGGCCCGGGCCGGGGGGGCCGAGGAGGCGGGGGCGGCAGGACGGGGGGCGGGGGCGGCCACCTGGCCCGGACCACCCCGGCCCGCCGCGCCGTCAA

CAAAGTGGTGTACGATGACCACGAGAGTGACGACGACGACGAGGAGGAGGACATGGTCTCGGAGGAGGACGAGGAGGAGGAGGAGGATGGCGACGCCGAG

GAGACCCAGGATTCCGAGGACGAGGAGGAAGATGACATGGAAGAAGACGACGATGACTCCGATTATCCGGAGGAGATGGAAGACGACGACGACGACGCTA

GTTACTGCACGGAAAGCAGCTTCAGGAGCCATAGTACATACAGCAGCACTCCAG - UNI5381 - - UNI18463 - GTAGGCGAAAACCAAGAGTA

CATCGGCCTCGTTCTCCAATATTAGAAGAAAAAGACATCCCACCCCTTGAATTTCCGAAGTCCTCTGAGGATTTAATGGTGCCTAATGAGCATATAATGA

ATGTCATTGCCATTTATGAGGTGGTGCGGAACTTTGGCAACGTTTTAAGGTTGTCCCCTTTTTGCTTTGAGGACTTCTGTGCGGCTCTGGTGAGCCAAGA

GCAGTGCACACTCATGGCGGAGATGCACGTGGCGCTTCTGAAAGCAGTTCTTCGAGAAGAGGACACGTCTAACACCACCTTTGGCCCTGCGGACTTGAAA

GACAGTGTAAACTCCACCCTGTATTTCATCGACGGGATGACGTGGCCGGAGGTCCTGAGGGTCTACTGTGAGAGTGACAAGGAGTACCACCATGTCCTTC

CTTACCAGGAGGCAGAGGACTATCCCTACGGACCAGTGGAGAACAAAATCAAAGTTCTGCAGTTTCTAGTCGATCAGTTCCTTACGACCAATATTGCTCG

TGAGGAGCTGATGTCTGAAGGGGTAATCCAGTATGACGACCATTGTAGGGTCTGTCACAAACTTGGGGATCTGCTGTGCTGTGAGACGTGCTCGGCTGTG

TACCATTTAGAGTGTGTGAAGCCGCCTCTTGAAGAAGTGCCGGAGGACGAGTGGCAGTGTGAAGTCTGTGTGGCACACAAGGTGCCTGGTGTGACTGACT

GTGTCGCTGAAGTCCAAAAGAATAAACCCTACGTTCGACACGAACCTATTGGGTATGACAGAAGCCGTAGGAAATACTGGTTTTTAAACCGAAGACTCAT

AAT AGAAGAAGACACAGACAATGAAAACGAGAAGAAAGTTTGGTACTACAGCACAAAGGTCCAGTTAGCAGAGCTAATAGACTGCCTAGACAAAGGATA

CTGGGAAGCAGAACTGTGCAGAGTTCTAGAAGACATTCGGGAGGAGATGCAGCAGCATATGGATGTAACGGAAGACCTGACCAACAAGGCTCGTGGCAGC

AACAAGTCCTTCCTAGCGGCAGCTAATG - UNI6861 - AGGAAATTTTGGACTCCTTAAGAATCAAACGAGGGGAAGATATTGACTGTGATCAGAGC

CCAGAAGACCCAGAAAAGGACAAGCATGAGGGCGAGAACAACAGCTCCAAGGATGCTGAGAAGAGCAGGGAGGAGGCGGAGGACCCTTCCGCAGACAAGG

ACGCTGACAGCAAAGGCCTGGAGGAAGAGCCCGGGCATGGAAAACCTGAGG - UNI3072 - AAGACTCTAACAGGACATGTGACAGCAGTAACACTA

GTGCTACCACTGCCTCCAGCCAGCCTAACCTGGAGACCTGCAGCAGCAGCGAGCTCACTTCTTCCCAGAGTGACTCTGCTAAGGCAGCGGATGACCCTGA

GATTGGAGAAAGAGACTCCCATACACCTGTCTCTGTTCACGAAGAGATAG GTGATTTCAGACTGGAGAAGTCCAATGGAGAAGTTTCCGAGTCCCCTGG

AGCTGGGAAAGGAACATCTGGGTCCACTCGTATCATCACCAGACTGAGGAACCCGGAGAGCAAACTCAGTCAGCTCAAGAGTCAGCAGGTGGCAGCTGCA

GCCCATGAAGCAAATAAATTGTTTAAGGAGGGGAAAGAG GTGCTGGTGGTTAACTCCCAAGGAGAGGTTTCACGGCTGAGCACCAAAAAGGAGGTGGTC

ATGAAAGGGAACATCAACAACTATTTTAAGCTGGGACAAGAAGGGAAGTATCGAGTCTACCACAATCAATACTCGACCAATTCATTTGCTCTGAATAAAC

ACCAGCACAGAGAAGACCATGATAAGAGGAGGCATCTTGCACATAAATTCTGTCTCACTCCAGCTGGGGAGTTCAAATGGAACGGGTCTGTTCACGGGTC

CAAAGTCCTTACCATCTCAACCCTGAGACTCACCATCACACAGCTAGAGAGCAACATTCCTTCATCCTTCCTTCACCCCAATTGGGCTTCACACAG GGC

TAATTGGATCAAGGCCGTTCAGATGTGTAGTAAACCCAGAGAGTTTGCGTTGGCTCTCGCAATTCTGGAGTGTGCAGTTAAGCCAGTTGTGATGCTGCCA

ATATGGCGGGAGTCTCTAGGACATACCCG - UNI29378 - GTTACATAGGATGACATCAATTGAAAGGGAAGAAAAAGAGAAAGTTAAAAAAAAGGA

GAAAAAACAAGAGGAGGAGGAGACAATGCAGCAGGCCACATGGGTAAAATACACATTTCCAGTGAAGCACCAG GTGACAGGGTACGGCGGCTGGAGCTG

GATTAGCAAGACGCACGTTTACAGATTTCTTCCCAAGTTACCAGGAAACACGAATGTAAACTACAGAAAGCCCTTGGATGGAG CCAAAAACAATACAGA

TGAAAATAAAGATGAGTCAGAGAAAAGGAAAAGTCCACGAAGTCCAAAAAAAATGAAGACAGAATGTGATTCTGAACAAGGTGAGACCAGAGATGCAGAT

GCCACAGCTGGAGCCGCCGCAGGGGCAATGGAGCTGTCTAAGGAACCTGAGAAGAAGGATCAAG ATGTAAAAGAACTTTTAGATTCTGATAATGACAAA

TCCTTCAAGGAAGAACCAATGGAGATCGATGATACCATAAAAACAGAGTCACACGTGAGCAGTCTGGAAAGCACAGAGGTAGATGTAGTCAATGTTAGTG

AGGGCTTCCATCTAAGGACTAGTTACAAAAAGAAAACGAAATCCTCTAAGCTGGACGGGCTTCTGGAACGGAGGATTCGACAATTTACACTGGAAGAAAA

ACAGCGTCTTGAGAAGTTAAAGCTGGAGAGTGGGGTGAAGGGGGCGGGGAAGCCCCCCATGGGTGCTCTGAAAAGCTCCTCTGAGTCTCCAGGCTCCACA

AAAGCAAGCGAAGGGCATCAGGGTGACTCGCTGAGACAGGAACAAAGCCCCAGTTCAAGTCAGGCTAGCACTGTGGACTTGGGGCTGGGGGGCTCACAAA

GTGATCCCTTGGTTCTTGGCATCAGTCCTCCTAGTCTAAGCACGCACAAACCTGATCCAAAAGATCAAGTATTAGATGATGTCTCCATTCAGAGTCCAGG

GCCAAACTGTCAGAGGCAAAACTCAGTTGAAAGCGACCTAGATGCCAGGATCTCTGAACCTGCCGGTAAGGGACTGGAACTAAGTCAGACTAAAACAGAA

GTGACTGACTCTTCCTCTGATGACTCTAAACCAACCAGTGCAGACGATGTTGGCATTTTGATCTGTAAGAGCAGAAAGCTGCACTCACAGGACGATAGCA

GCACCGTTGTGTCTTCTTCCAAGAGTACTTTACCTGCATCAGTACCTAAAAGTCCCCGTGACAGAGATGCCCGGGCCTTCTCAAAAGCAGTGGACTTCGA

TGGGAGACTAGGTGGTGACTCTGAATATAGTAGCACTTTGGAAAATAGCTCTGATAATATGTGTATTCGGGACAGTGCTGAAGAAGATATGGTTGTTCAG

AACAGCAGTGAAGCCACCTCGAAACGGTTCATAGCTCCAGAACAAGGAGGAGAAAGCGTGGAGTCGACAAAATGTCAGGTAGTTTCTAAGTCCACTGAAA

ACTGTGAAGACAAACTACAGGGTAAGGTAACTGAAGCAAACGGTAAGAAACTGGGCCAACATCCTCCAAAGCCAGAGGAGAGAGCAGTTAACAGATGTAC

TGACCAAGTCAGCCTGCGACACAGCGTTGACAGAAAGAACAGTGAACCTCGAGAGTCTGAAAAGAAAGGACAGAAAGCAAATAAATTTCAAATAAACGGC

AAAGATAGCAAAGCTAAGGGGTACCTGAAGGGGCCGGGCACGAAGGACGGCTCTGATGGTAAAGTTGTGAGTAGTGCTGTAGAACCAAAGGTCAATAATA

TCAATAAAGTCATCCCTGGGAATACCAAGTCACTGGCTGGGAAGGAATCTGCTGCGAAGCCGTTCATCAACGGTGACATCATTATGGAAGAGTTGAGTGA

ACAAAACACTTCAGAAACCAACTCATACTCACTGAGTTCTTCAGATGCCAAAGGTAATCACCAAGATGGCCTCCATACCCTACCATCCACCAAAGAGTCT

GCCAGTACCCAGGTAATCACACCCCGAGCCCCTTGTCCAGATCGGAACTCACTTAGTCAGGTAGAAGATATGGAAACTGAAAGTCCAGAGGTTAAGAGAG

TTATCCCGTCTCCTGTTAGAACTGGAGAGGGCTCTAACCTTAGCAAGGGCTTCATGGATGACAATGGACTGCCTTCCAGCAAAGACGAGAACGTCAATGG

AGAATCCCAAAGAAAGACGGTCATCACAGAAGTCACCACAATGACATCTACTGTTGCCACAGAATCAAAAACTGTCATTAAGGTAGCAAAAGGAGACAAG

CAAACTGTGGTTTCTTCCACAGAAAATTGTGCCAGATCCACAGTCACAACTACCACTACCACTGTGACAAAGCTCTCCACACCCTCCCCAGACACCGGTG

TGGATACCATCTCTGTAAAGGAGCAGAGTAAAACCGTGGTCACCACGACAGTGACGGACTCCTTGACCACTGCAGGAAGCACACTGGTGACATCTATGAC

CGTGAGCAAAGAGTACTCCACGAGAGACAGGGTAAAGCTGATGAAGTTCTCACGACCCAAGAAGACCCGCTCAGGCACTGCCCTGCCGTCCTATAGGAAG

TTCGTTACCAAGAGCAGCAAAAAGAGCATATTTGTGTTACCTAATGATGACTTGAAAAAGCTGGCCAGGAAAGGAGGGATCCGGGAGGTCCCTTACTTTA

ATTATAACGCGAAACCTGCCTTGGATATATGGCCATACCCTTCTCCTAGACCGACCTTTGGTATCACATGGAG GTATAGACTACAGACGGTAAAGTCCT

TGGCTGGAGTGAGCCTGATGTTACGGTTGCTGTGGGCCAGTTTGAGATGGGATGACATGGCAGCCAAGGCTCCTCCAGGAGGAGGGTCTACACGGACAG 

- UNI4570 - - UNI9390 - AAACATCTGAAACTGAAATCACAACCACTGAGATAATTAAGAGGCGTGATGTGGGCCCTTATGGCATTCGTTCTGA

GTATTGTATCAGGAAGATCATTTGCCCCATTGGAGTTCCAGAAGCACCAAAAG - UNI4570 - AAACACCCACACCTCAGCGGAAGGGCCTCCGATC

AAGTGCACTTCGGCCAAAGAGACCAGAGACCCCCAAGCAGACGGGCCCTGTTATCATTGAGAGCTGGGTAGCAGAAGAAGAGCTGGAGCTCTGGGAGATC

AGGGCTTTTGCTGAGAG AGTGGAGAAAGAAAAGGCTCAAGCAGCAGAGCAGCAGACCAAG AAACGTTTGGAGCAGCAGAAGCCTGCAGTCATCGCAGC

GTCCACCACGTCCCCAGCAAACAACACAAGCAGCACTGTCTCTCCAGCCCAGAAGGTGATGGTGGCTCCCTTAAGTGGCTCGGTCACCCCTGGAACAAAG

ATGGTGCTGGCCACAAAAGTCGGCTCGCCTGCCACAGTCACATTCCAGCAAAACAAGAACTTCCATCAAACTTTTGCCACGTGGGTGAAGCAAGGCCAGT

CCAATTCAG - UNI319 - GCATGGTCCAGGTACAGCAGAAGGTCCTGGGGATCATTCCATCGACTACAGGTCCAAGCCAGCAAACCTTTACTTCATT

CCAGCCCAGGACTGCAACTGTCACAATTAGGCCCAATACCTCAGCCTCTGCAGGAACCACTACCACATCACAG - UNI319 - GTGATCACAGGGCCT

CAGATCCGCCCTGGCATGACAGTGATTAGAACGCCACTCCAGCAGCCAGCACTGGGAAAGGCGATCATTCGAACACCAGTGGTGGTGCAGCCAG GCACA

CCCCAACAAGTTGTGACTCAAATCATCCGAGGACAGCCTGTTTCCACTGCCATCTCTGCTCCAAGTACAGCTTCCTCAGCACCTGTACAAAAGGGCTTAA

CTCCAGGAGCAGCGGCTGGGCCTCTGCAGCCTTCAGCCCCACACAGCCCTCGTCCTCAGCAAGGGCAGGTGAAGCTCACCATGGCTCAGCTCACTCAGCT

CACGCAGGGCCAT GGCGGCAACCAAGGTTTAACAGTAGTGATTCAAGGACAAGGGCAGACTACTGGACAGTTGCAGTTGATACCTCAGGGGATGACAGT

CCTTCCAGGGCCAGGGCAGCAGCTCATGCAAGCTGCAATGCCGAATGGCACCGTTCAGCGTTTCCTCTTTACCCCACTATCAACATCAGCCACGGCCGCC

AGCAGCAGCAGCAACAGCAGCAGCACCACTACTAATGCTACAGCAGCAG - UNI4795 - GCTCAGGGGAACAAAAACAGAGTAAAATATTACCCCAG

ACCCAGGTACAACCAGCCACAACCCTGGCACCAACTCAGTCATCAAGTGTGAGTCCTGCAGAAGCCCAGCCACAGCCTGCTCAGCCTGCAGCACAACCCC

AGCCCCAGCCCCAGCCCCCAGCTCAGCCTGAAGTCCAGACCCAGCCAGCTGTCTCGTCCCATGTCCCTTCTGAAACACAGCCCTCCCAAGCACAGACATC

TAAACCCCTGGTTGCAACACAGTGTCAGCCTCAGAGCAGTGTACAAGGACAGTCTCCTGTTCGAGTCCAGAGTCCACCACTGACTCGAATACGTCCATCA

ACTCCATCCCAAGTGACTCCTGGACAGCAACCCCAGGTTCAGACTACAGCTTCACAGCCGATTCCAATTCCGCCCCCCACATCTCTGCAGGCACCTTCCC

AAGGCCAGCCACAGTCACAGCCCCAGGTACAGTCTTCAACTCAAACTCTTTCATCAGGACAGACATTAAATCAAGTTACTGTTCTATCTCCATCCTGTCC

TCAGCCACAGCCCCAAGTCATTGCTGTGCCTCAGCTCCAGCAAGTCCAGGTTCTCTCTCAGATCCAGTCGCAGGTTGTGGCTCAGATACAGGCCCAGCAA

AGTGGTGTGCCCCAGCAAATCAAACTTCAGTTGCCCATTCAAGTTCAGCAAAACAGTGCTGCGCAGACTCAGAGTGTGGTCACAGTGCAGGCAGCCAGTG

TGCAGGAGCAGTTGCAGAGGGTTCAGCAACTCAGGGACCAGCAGCAAAAGAAGAAGCAGCAGATAGAAACTGAGCGTGAACACACCCTCCAAGCTTCTAA

CCAAAGTGAGATCATTCAGAAACAG GTGGTGATGAAGCATAATGCTGTAATAGAACATTTAAAACAGAAAAAGACCATGACTCCAGCTGAAAGAGAAGA

AAATCAAAG GATGATTGTCTGTAACCAGGTGATGAAGTATATTCTGGATAAGATAGATAAAGAAGAAAAACAGGCGGCCAAGAAACGCAAGCGGGAGGA

GAGTGTGGAGCAGAAGCGGAGCAAACAGAATGCCAGCAAGCTCTCTGCTCTGCTGTTCAAACACAAGGAGCAGCTCAAAGCTGAGATCCTGAGAAAGAGA

GCGCTCCTGGACAAAGAGTTGCAGATCCAAGTGCAG - UNI2408 - - UNI14259 - - UNI18077 - GAAGAGCTGAAAAGAGACCTGAAAA

TGAAACGAGAGAGGGAGATGGCCCAGGCGGTACAGGCCAATGCTGCCTCAGTGCCCACACCCTCCGTGCCAGCCCCTGTGCCAGCGCCTGCACCGGCAGC

CCCTCCAGCTCCTCCTCGTTCTCCGCCTCCCTCCACACACAGTCTGCCACCTGCAGGCCACCCCACAGCCCCACTGCCTGTCACTTCCCAGAAGAGGAAG

CGGGAGGAAGAGAAGGACTCTAAGTCCAAGAAGAAGAAGATGATCTCTACCACCTCTAAGGAGGCCAAGAAGGACACCAGGCTATATTGCATCTGCAAGA

CACCGTACGATGAGTCCAA - UNI6145 - - UNI14259 - - UNI18077 - ATTTTATATTGGCTGTGATCGGTGTCAGAATTGGTACCACGG

GCGCTGTGTTGGCATCTTGCAAAGTGAGGCAGATCTCATTGATGAGTATGTCTGTCCACAGTGCCAGTCGACAGAGGACGCCATGACAGTGCTCACACCA

CTGACAGAGAAAGATTATGAGGGCTTGAAGAGGGTGCTGCGCTCCTTACAG - UNI6145 - - UNI6151 - - UNI14259 - GCCCACAAGAT

GGCGTGGCCTTTCCTTGAACCGGTAGACCCCAATGATGCACCGGATTATTACGGTGTTATTAAAGAGCCAATGG - UNI6151 - - UNI33645 - 

ACCTTGCCACCATGGAAGAAAGAATACAAAAACGGTATTATGAAAAGCTGACAGAGTTCGTGGCAGATATGACCAAAATTTTTGATAACTGCCGTTATTA

CAATCCCCGTGACACCCCTTTTTACCAGTGTGCAGAAGTTCTTGAATCATTCTTTGTACAGAAACTAAAAGGATTCAAGGCCAGCAG - UNI20438 -

 - UNI33645 - GTCTCATAACAACAAGCTGCAATCTACAGCTCCTTAGAACTCAGCGTGTCTGTCACCTAAGCTAGACACAGCAAGTCTGGCGCTCT

GAACTATTTAAACTAAAGCGCCAGATATTTTCAGTCAGGCTTTCCTGACAAGACCGTAACCTCGTTCATATTGGTCACAACAGTCCAGTTGTATTCTTGG

CCAATTTTGTCCAACGGACAAAGGAAAAGCAAAGTCAACGGCACCGTTGTCTTGTCGAGAGCAAATGGCTTTACTATTGTGGCAGAAGCAGGAAACTTTG

TTTATTGGAAAAAAAAAAAAAAAAAAGAAAAAGCAAGAAAAAAAAAAAAAGATACTATGGGGTCAAGTGTAACTCCGTGGGATGCCACATCTGCTCTTCA

GTGAAGAAGCTGTTTAGAGTCTCAGAAAACTTTTTGACTGTATTTATTTATTGTTGCAAAAAAAAGACGCTTTTTTATTGCTGCCCTCATTTGTCAGCTA

ATTATTTTTTCTTATACAAATCCAGCCCTGGTTCCGTGTATCCACCCTGTATCCTATCATGATTCCTGTAGGTGAAGTACAAGGCGACCTCTAGGTGTCT

TTTCTTTCTATGAAAGGAGCTGCTATGTACACATGTGCACACACAACTGGGAATCAACAATGAGTTTATTGTTCACGGGAGACACAAGTGAAGCTTGCGG

AAAGGTTGGGCTAAGTGGTCCTGGACTAACAGACTTCGTTGCCTTGAATACACCAGTACAAATTGTCATTTACTCTGCACCAGGCTAAATGAGCAAAATC

TATTTGAAGGTATCTTGTTTGTAAACATTGTCAGATTCTAATTTTTTTCTTTTTGTATTAAAATTCAACTATGGATGTATACGAATCGAAATAAATGGAG

ATCATTTTTCTCCCACAGATGGAGGTCTCTTTGAATGTGCGCTGTGATTACCTGTAAGCCTTTGTGGGGGACGGGGCGGGGGAGAGACCAGGAATGACAG

GAAGACCTGGATTTCTCTAGAATAGCAGAGGCCCTTCCTTTCCTAAGTCCCTTCTCACCACATCAGAGAAAATCTCCAGGGAGCCGGTCCCTTGCATCTC

TTGGTCATCCCTGTAATAACGGGAATATGACACAGTACAAGCTGCCTTCATCCCCGCCTTCCAAAACTGTAGACAGATTCCTGTGTGGGATGAAGGGTGT

TTGCTGGCCGGGTTCCTTGGGTTTTGTTTGTTGCAGTAGAGCAGGGTAGAGGGTAGAGCAGACAGGCTCGCCCTGCATCTTCCTCCTGCGGGTGCTCTCA

CCCTCCCTCCCCTTGGAGCTGCTTGCTGTGTTGTGAAAACCAGCCAGGATTGAGTCAGGCTGCCTCGCAGATGTTTTCCTAGATTTGCACTAGTCCATGT

TAGCCCTGTCCTGCTGGGTTCTAGAATCTACCTAGTTTTTGTTTTTTAAAAGCCGCCTCTGTGCATTTGGTGTCGCCCTGCTATGCAAAGCCTTCCCCAG

CCCTTAGTTTCTTGAAAGGAAACTGTGGCAGCAGTTGGCAAATTCTTCCTTATGACAGGCTCAGGTGTACAGGTTCTTCTGGGTCACGTGCTCTATGGAA

GCCTACTCCCTCTGTACATAAAAATGTCACTTTAGCCTGTGCTTACAGCTAAAGAGACTTAACTGCTCAATATGATAGCAAAGTTTTTGCTTAAACTATT

AAGGTGGAAGTAGTTAAATACAGGCTATTTTGTTCTTTTAGTTTACAAAAAAGAAAAAAGAAAAAAAATGTTCCACGTTGTAGGCACTGTGCTGATGCAA

GAATTCTACATCCTAATAATACAAAGTGATTCTGCATCTGCCCACGTCCAGTATTCCTGTACTATCTATTCATATATCTAAGCATATATGGGCTTAATCA

CTTAAGCTTGTTGCAGCAAAAGCTTTCCTACCTGTAGGCAATAGATTGCTATGTTTTTAACAAATTGTAGCAAATTCTAAATAATCCTTTTTGTACGTAA

TAGGACATTTCATCCTAAAAAATAAAGTAATGTTTTTGACATTGGATTCTGTGCAGTTTCTAATGAGACAATGACTGGTTGGGTCAATGTTTGCTATATT

TTTCTGAAGCTGTTGGCATTGCCAAGTTGTACAGAAATGGGGGTGGGTATGGGTTGTGGATTTCTGAGACCAGGAAGATGTTAATTTCTTATTTGTGTAC

TTAATGATATAAAGACTTTTGCAGTTTCTATCACCATGTAAAGACATTTTATAGTTTTATCAGACTGTGGAGTTTTAGTCTTTCAACGTACATTTATTTC

AAAAGCTGCTTTTCTACAGATCTCATTTGACCTTCTTCTACTCCTCAATAAAAGTGTTAGGCTGTCTGCTCCGTCCGGCAGACCAAGTGGTCCGATATGC

GATATGGGTAGGACTCAGGTTCTGTGCCTAGAAGTTGTATTTCTTTGCTTTGATAGATTTCTTTGGCTAAAAGTATTTTTTAGCATTTCCTGTGTTCATC

TCCAGATTCACAGTTTAAGACCATTTCTTAAGAGATATTTTCATAACGGCGGTAAGGCTTTTTTCTCCTGTGCAGGTTCTTCAGGGCTTGTATTTACTGT

CCTGTGCTAGGTCAAAGAAATTGCGAACTTTTGGAGATGTTTTCTACAGTAAAAAAATGACCTTTTTCTATTTGGAGTGGCCTGGAGTGCTGTGTGGGAC

CCTCCCAATGTGCTGCTGTCTGTAACCTGTCCTCTTAAGAGCTGCAAATAAAACTTCTCTCCCTGTCTCCG
Translation
MRGRRGRPPKQPAAPAAERCAPAPPPPPPPPPPPPPPPPPPPPASGPIGGLRSRHRGSSRGRWAAAQAEVAPKTRLSSPRGGGRRKQPPPPPPASGSSAS

GPGRGGRGGGGGRTGGGGGHLARTTPARRAVNKVVYDDHESDDDDEEEDMVSEEDEEEEEDGDAEETQDSEDEEEDDMEEDDDDSDYPEEMEDDDDDASY

CTESSFRSHSTYSSTPG - UNI5381 - - UNI18463 - GRRKPRVHRPRSPILEEKDIPPLEFPKSSEDLMVPNEHIMNVIAIYEVVRNFGNVLR

LSPFCFEDFCAALVSQEQCTLMAEMHVALLKAVLREEDTSNTTFGPADLKDSVNSTLYFIDGMTWPEVLRVYCESDKEYHHVLPYQEAEDYPYGPVENKI

KVLQFLVDQFLTTNIAREELMSEGVIQYDDHCRVCHKLGDLLCCETCSAVYHLECVKPPLEEVPEDEWQCEVCVAHKVPGVTDCVAEVQKNKPYVRHEPI

GYDRSRRKYWFLNRRLII IEEDTDNENEKKVWYYSTKVQLAELIDCLDKGYWEAELCRVLEDIREEMQQHMDVTEDLTNKARGSNKSFLAAANE - UN

I6861 - EEILDSLRIKRGEDIDCDQSPEDPEKDKHEGENNSSKDAEKSREEAEDPSADKDADSKGLEEEPGHGKPEE - UNI3072 - EDSNRTCD

SSNTSATTASSQPNLETCSSSELTSSQSDSAKAADDPEIGERDSHTPVSVHEEIG GDFRLEKSNGEVSESPGAGKGTSGSTRIITRLRNPESKLSQLKS

QQVAAAAHEANKLFKEGKE VLVVNSQGEVSRLSTKKEVVMKGNINNYFKLGQEGKYRVYHNQYSTNSFALNKHQHREDHDKRRHLAHKFCLTPAGEFKW

NGSVHGSKVLTISTLRLTITQLESNIPSSFLHPNWASHR RANWIKAVQMCSKPREFALALAILECAVKPVVMLPIWRESLGHTR - UNI29378 - R

LHRMTSIEREEKEKVKKKEKKQEEEETMQQATWVKYTFPVKHQ VTGYGGWSWISKTHVYRFLPKLPGNTNVNYRKPLDGA AKNNTDENKDESEKRKSP

RSPKKMKTECDSEQGETRDADATAGAAAGAMELSKEPEKKDQD DVKELLDSDNDKSFKEEPMEIDDTIKTESHVSSLESTEVDVVNVSEGFHLRTSYKK

KTKSSKLDGLLERRIRQFTLEEKQRLEKLKLESGVKGAGKPPMGALKSSSESPGSTKASEGHQGDSLRQEQSPSSSQASTVDLGLGGSQSDPLVLGISPP

SLSTHKPDPKDQVLDDVSIQSPGPNCQRQNSVESDLDARISEPAGKGLELSQTKTEVTDSSSDDSKPTSADDVGILICKSRKLHSQDDSSTVVSSSKSTL

PASVPKSPRDRDARAFSKAVDFDGRLGGDSEYSSTLENSSDNMCIRDSAEEDMVVQNSSEATSKRFIAPEQGGESVESTKCQVVSKSTENCEDKLQGKVT

EANGKKLGQHPPKPEERAVNRCTDQVSLRHSVDRKNSEPRESEKKGQKANKFQINGKDSKAKGYLKGPGTKDGSDGKVVSSAVEPKVNNINKVIPGNTKS

LAGKESAAKPFINGDIIMEELSEQNTSETNSYSLSSSDAKGNHQDGLHTLPSTKESASTQVITPRAPCPDRNSLSQVEDMETESPEVKRVIPSPVRTGEG

SNLSKGFMDDNGLPSSKDENVNGESQRKTVITEVTTMTSTVATESKTVIKVAKGDKQTVVSSTENCARSTVTTTTTTVTKLSTPSPDTGVDTISVKEQSK

TVVTTTVTDSLTTAGSTLVTSMTVSKEYSTRDRVKLMKFSRPKKTRSGTALPSYRKFVTKSSKKSIFVLPNDDLKKLARKGGIREVPYFNYNAKPALDIW

PYPSPRPTFGITWR RYRLQTVKSLAGVSLMLRLLWASLRWDDMAAKAPPGGGSTRTE - UNI4570 - - UNI9390 - ETSETEITTTEIIKRRD

VGPYGIRSEYCIRKIICPIGVPEAPKE - UNI4570 - ETPTPQRKGLRSSALRPKRPETPKQTGPVIIESWVAEEELELWEIRAFAER RVEKEKAQ

AAEQQTK KRLEQQKPAVIAASTTSPANNTSSTVSPAQKVMVAPLSGSVTPGTKMVLATKVGSPATVTFQQNKNFHQTFATWVKQGQSNSG - UNI319

 - GMVQVQQKVLGIIPSTTGPSQQTFTSFQPRTATVTIRPNTSASAGTTTTSQ - UNI319 - VITGPQIRPGMTVIRTPLQQPALGKAIIRTPVVV

QPG GTPQQVVTQIIRGQPVSTAISAPSTASSAPVQKGLTPGAAAGPLQPSAPHSPRPQQGQVKLTMAQLTQLTQGH GGNQGLTVVIQGQGQTTGQLQL

IPQGMTVLPGPGQQLMQAAMPNGTVQRFLFTPLSTSATAASSSSNSSSTTTNATAAG - UNI4795 - GSGEQKQSKILPQTQVQPATTLAPTQSSSV

SPAEAQPQPAQPAAQPQPQPQPPAQPEVQTQPAVSSHVPSETQPSQAQTSKPLVATQCQPQSSVQGQSPVRVQSPPLTRIRPSTPSQVTPGQQPQVQTTA

SQPIPIPPPTSLQAPSQGQPQSQPQVQSSTQTLSSGQTLNQVTVLSPSCPQPQPQVIAVPQLQQVQVLSQIQSQVVAQIQAQQSGVPQQIKLQLPIQVQQ

NSAAQTQSVVTVQAASVQEQLQRVQQLRDQQQKKKQQIETEREHTLQASNQSEIIQKQ VVMKHNAVIEHLKQKKTMTPAEREENQR RMIVCNQVMKYI

LDKIDKEEKQAAKKRKREESVEQKRSKQNASKLSALLFKHKEQLKAEILRKRALLDKELQIQVQ - UNI2408 - - UNI14259 - - UNI18077

 - EELKRDLKMKREREMAQAVQANAASVPTPSVPAPVPAPAPAAPPAPPRSPPPSTHSLPPAGHPTAPLPVTSQKRKREEEKDSKSKKKKMISTTSKEA

KKDTRLYCICKTPYDESK - UNI6145 - - UNI14259 - - UNI18077 - KFYIGCDRCQNWYHGRCVGILQSEADLIDEYVCPQCQSTEDAM

TVLTPLTEKDYEGLKRVLRSLQ - UNI6145 - - UNI6151 - - UNI14259 - AHKMAWPFLEPVDPNDAPDYYGVIKEPMD - UNI6151 

- - UNI33645 - DLATMEERIQKRYYEKLTEFVADMTKIFDNCRYYNPRDTPFYQCAEVLESFFVQKLKGFKASR - UNI20438 - - UNI336

45 - RSHNNKLQSTAP
Transcript ENSMUST00000041145
Sequence
GGATATATGGCCATACCCTTCTCCTAGACCGACCTTTGGTATCACATGGAG GTATAGACTACAGACGGTAAAGTCCTTGGCTGGAGTGAGCCTGATGTT

ACGGTTGCTGTGGGCCAGTTTGAGATGGGATGACATGGCAGCCAAGGCTCCTCCAGGAGGAGGGTCTACACGGACAG - UNI4570 - - UNI9390 

- AAACATCTGAAACTGAAATCACAACCACTGAGATAATTAAGAGGCGTGATGTGGGCCCTTATGGCATTCGTTCTGAGTATTGTATCAGGAAGATCATT

TGCCCCATTGGAGTTCCAGAAGCACCAAAAG - UNI4570 - AAACACCCACACCTCAGCGGAAGGGCCTCCGATCAAGTGCACTTCGGCCAAAGAGA

CCAGAGACCCCCAAGCAGACGGGCCCTGTTATCATTGAGAGCTGGGTAGCAGAAGAAGAGCTGGAGCTCTGGGAGATCAGGGCTTTTGCTGAGAG AGTG

GAGAAAGAAAAGGCTCAAGCAGCAGAGCAGCAGACCAAG AAACGTTTGGAGCAGCAGAAGCCTGCAGTCATCGCAGCGTCCACCACGTCCCCAGCAAAC

AACACAAGCAGCACTGTCTCTCCAGCCCAGAAGGTGATGGTGGCTCCCTTAAGTGGCTCGGTCACCCCTGGAACAAAGATGGTGCTGGCCACAAAAGTCG

GCTCGCCTGCCACAGTCACATTCCAGCAAAACAAGAACTTCCATCAAACTTTTGCCACGTGGGTGAAGCAAGGCCAGTCCAATTCAG CCACCAGCACAG

CTGCCACCTCTGCTACCACCATTGCCAGCACAGGTCAGACGTTCCAAATTACGGGCAGTCCCGTCACTATGGCAGGAAAAGTAATTACCAAATTGCCACT

TCCTGCAAACAGCAAGATTGTCGCTGTAAATGTGCCAGCAACACAAGGAG - UNI319 - GCATGGTCCAGGTACAGCAGAAGGTCCTGGGGATCATT

CCATCGACTACAGGTCCAAGCCAGCAAACCTTTACTTCATTCCAGCCCAGGACTGCAACTGTCACAATTAGGCCCAATACCTCAGCCTCTGCAGGAACCA

CTACCACATCACAG - UNI319 - GTGATCACAGGGCCTCAGATCCGCCCTGGCATGACAGTGATTAGAACGCCACTCCAGCAGCCAGCACTGGGAAA

GGCGATCATTCGAACACCAGTGGTGGTGCAGCCAG GCACACCCCAACAAGTTGTGACTCAAATCATCCGAGGACAGCCTGTTTCCACTGCCATCTCTGC

TCCAAGTACAGCTTCCTCAGCACCTGTACAAAAGGGCTTAACTCCAGGAGCAGCGGCTGGGCCTCTGCAGCCTTCAGCCCCACACAGCCCTCGTCCTCAG

CAAGGGCAGGTGAAGCTCACCATGGCTCAGCTCACTCAGCTCACGCAGGGCCAT GGCGGCAACCAAGGTTTAACAGTAGTGATTCAAGGACAAGGGCAG

ACTACTGGACAGTTGCAGTTGATACCTCAGGGGATGACAGTCCTTCCAGGGCCAGGGCAGCAGCTCATGCAAGCTGCAATGCCGAATGGCACCGTTCAGC

GTTTCCTCTTTACCCCACTATCAACATCAGCCACGGCCGCCAGCAGCAGCAGCAACAGCAGCAGCACCACTACTAATGCTACAGCAGCAG - UNI4795

 - GCTCAGGGGAACAAAAACAGAGTAAAATATTACCCCAGACCCAGGTACAACCAGCCACAACCCTGGCACCAACTCAGTCATCAAGTGTGAGTCCTGC

AGAAGCCCAGCCACAGCCTGCTCAGCCTGCAGCACAACCCCAGCCCCAGCCCCAGCCCCCAGCTCAGCCTGAAGTCCAGACCCAGCCAGCTGTCTCGTCC

CATGTCCCTTCTGAAACACAGCCCTCCCAAGCACAGACATCTAAACCCCTGGTTGCAACACAGTGTCAGCCTCAGAGCAGTGTACAAGGACAGTCTCCTG

TTCGAGTCCAGAGTCCACCACTGACTCGAATACGTCCATCAACTCCATCCCAAGTGACTCCTGGACAGCAACCCCAGGTTCAGACTACAGCTTCACAGCC

GATTCCAATTCCGCCCCCCACATCTCTGCAGGCACCTTCCCAAGGCCAGCCACAGTCACAGCCCCAGGTACAGTCTTCAACTCAAACTCTTTCATCAGGA

CAGACATTAAATCAAGTTACTGTTCTATCTCCATCCTGTCCTCAGCCACAGCCCCAAGTCATTGCTGTGCCTCAGCTCCAGCAAGTCCAGGTTCTCTCTC

AGATCCAGTCGCAGGTTGTGGCTCAGATACAGGCCCAGCAAAGTGGTGTGCCCCAGCAAATCAAACTTCAGTTGCCCATTCAAGTTCAGCAAAACAGTGC

TGCGCAGACTCAGAGTGTGGTCACAGTGCAGGCAGCCAGTGTGCAGGAGCAGTTGCAGAGGGTTCAGCAACTCAGGGACCAGCAGCAAAAGAAGAAGCAG

CAGATAGAAACTGAGCGTGAACACACCCTCCAAGCTTCTAACCAAAGTGAGATCATTCAGAAACAG GTGGTGATGAAGCATAATGCTGTAATAGAACAT

TTAAAACAGAAAAAGACCATGACTCCAGCTGAAAGAGAAGAAAATCAAAG GATGATTGTCTGTAACCAGGTGATGAAGTATATTCTGGATAAGATAGAT

AAAGAAGAAAAACAGGCGGCCAAGAAACGCAAGCGGGAGGAGAGTGTGGAGCAGAAGCGGAGCAAACAGAATGCCAGCAAGCTCTCTGCTCTGCTGTTCA

AACACAAGGAGCAGCTCAAAGCTGAGATCCTGAGAAAGAGAGCGCTCCTGGACAAAGAGTTGCAGATCCAAGTGCAG - UNI2408 - - UNI14259

 - - UNI18077 - GAAGAGCTGAAAAGAGACCTGAAAATGAAACGAGAGAGGGAGATGGCCCAGGCGGTACAGGCCAATGCTGCCTCAGTGCCCACA

CCCTCCGTGCCAGCCCCTGTGCCAGCGCCTGCACCGGCAGCCCCTCCAGCTCCTCCTCGTTCTCCGCCTCCCTCCACACACAGTCTGCCACCTGCAGGCC

ACCCCACAGCCCCACTGCCTGTCACTTCCCAGAAGAGGAAGCGGGAGGAAGAGAAGGACTCTAAGTCCAAGAAGAAGAAGATGATCTCTACCACCTCTAA

GGAGGCCAAGAAGGACACCAGGCTATATTGCATCTGCAAGACACCGTACGATGAGTCCAA - UNI6145 - - UNI14259 - - UNI18077 - A

TTTTATATTGGCTGTGATCGGTGTCAGAATTGGTACCACGGGCGCTGTGTTGGCATCTTGCAAAGTGAGGCAGATCTCATTGATGAGTATGTCTGTCCAC

AGTGCCAGTCGACAGAGGACGCCATGACAGTGCTCACACCACTGACAGAGAAAGATTATGAGGGCTTGAAGAGGGTGCTGCGCTCCTTACAG - UNI61

45 - - UNI6151 - - UNI14259 - GCCCACAAGATGGCGTGGCCTTTCCTTGAACCGGTAGACCCCAATGATGCACCGGATTATTACGGTGTTA

TTAAAGAGCCAATGG - UNI6151 - - UNI33645 - ACCTTGCCACCATGGAAGAAAGAATACAAAAACGGTATTATGAAAAGCTGACAGAGTTC

GTGGCAGATATGACCAAAATTTTTGATAACTGCCGTTATTACAATCCCCGTGACACCCCTTTTTACCAGTGTGCAGAAGTTCTTGAATCATTCTTTGTAC

AGAAACTAAAAGGATTCAAGGCCAGCAG - UNI20438 - - UNI33645 - GTCTCATAACAACAAGCTGCAATCTACAGCTCCTTAGAACTCAGC

GTGTCTGTCACCTAAGCTAGACACAGCAAGTCTGGCGCTCTGAACTATTTAAACTAAAGCGCCAGATATTTTCAGTCAGGCTTTCCTGACAAGACCGTAA

CCTCGTTCATATTGGTCACAACAGTCCAGTTGTATTCTTGGCCAATTTTGTCCAACGGACAAAGGAAAAGCAAAGTCAACGGCACCGTTGTCTTGTCGAG

AGCAAATGGCTTTACTATTGTGGCAGAAGCAGGAAACTTTGTTTATTGG
Translation
 MAAKAPPGGGSTRTE - UNI4570 - - UNI9390 - ETSETEITTTEIIKRRDVGPYGIRSEYCIRKIICPIGVPEAPKE - UNI4570 - ET

PTPQRKGLRSSALRPKRPETPKQTGPVIIESWVAEEELELWEIRAFAER RVEKEKAQAAEQQTK KRLEQQKPAVIAASTTSPANNTSSTVSPAQKVMV

APLSGSVTPGTKMVLATKVGSPATVTFQQNKNFHQTFATWVKQGQSNSA ATSTAATSATTIASTGQTFQITGSPVTMAGKVITKLPLPANSKIVAVNVP

ATQGG - UNI319 - GMVQVQQKVLGIIPSTTGPSQQTFTSFQPRTATVTIRPNTSASAGTTTTSQ - UNI319 - VITGPQIRPGM   - UNI4

795 -    - UNI2408 - - UNI14259 - - UNI18077 -  - UNI6145 - - UNI14259 - - UNI18077 -  - UNI6145 - -

 UNI6151 - - UNI14259 -  - UNI6151 - - UNI33645 -  - UNI20438 - - UNI33645 - 
Transcript ENSMUST00000057892
Sequence
GAAACAAGATGGCGGCTGCAGGCGATCCGGAGCGGGGCCCCGGCAATTCGGACTGAGCCTTCTCCCTCCACCCCGCCGCTGCCGGGCCGCGCCCCTCCCG

CCCGGACCCCGGCGCCCTCCCCTCCCCCTCGGCCCCGGCGCCCCCCGCGCCCCTCCCCCACCCCTTCCGCTCCCCCCCCACCCCCCCGCAAGCCGCGGCT

CCGACATGAGGGGCCGGCGGGGCAGGCCGCCCAAGCAGCCCGCGGCTCCTGCTGCGGAGCGCTGCGCCCCGGCCCCGCCGCCGCCGCCGCCGCCGCCACC

ACCGCCGCCGCCACCGCCGCCGCCGCCGCCGCCCGCCTCCGGACCCATAGGGGGGCTGCGCTCGCGGCACCGCGGCAGCAGTCGGGGCAGGTGGGCCGCC

GCCCAGGCTGAGGTGGCGCCCAAGACCCGGTTGAGCTCGCCCAGGGGGGGCGGCCGCAGGAAACAGCCGCCACCGCCACCGCCGGCCTCCGGCAGCAGCG

CCAGCGGCCCGGGCCGGGGGGGCCGAGGAGGCGGGGGCGGCAGGACGGGGGGCGGGGGCGGCCACCTGGCCCGGACCACCCCGGCCCGCCGCGCCGTCAA

CAAAGTGGTGTACGATGACCACGAGAGTGACGACGACGACGAGGAGGAGGACATGGTCTCGGAGGAGGACGAGGAGGAGGAGGAGGATGGCGACGCCGAG

GAGACCCAGGATTCCGAGGACGAGGAGGAAGATGACATGGAAGAAGACGACGATGACTCCGATTATCCGGAGGAGATGGAAGACGACGACGACGACGCTA

GTTACTGCACGGAAAGCAGCTTCAGGAGCCATAGTACATACAGCAGCACTCCAG - UNI5381 - - UNI18463 - GTAGGCGAAAACCAAGAGTA

CATCGGCCTCGTTCTCCAATATTAGAAGAAAAAGACATCCCACCCCTTGAATTTCCGAAGTCCTCTGAGGATTTAATGGTGCCTAATGAGCATATAATGA

ATGTCATTGCCATTTATGAGGTGGTGCGGAACTTTGGCAACGTTTTAAGGTTGTCCCCTTTTTGCTTTGAGGACTTCTGTGCGGCTCTGGTGAGCCAAGA

GCAGTGCACACTCATGGCGGAGATGCACGTGGCGCTTCTGAAAGCAGTTCTTCGAGAAGAGGACACGTCTAACACCACCTTTGGCCCTGCGGACTTGAAA

GACAGTGTAAACTCCACCCTGTATTTCATCGACGGGATGACGTGGCCGGAGGTCCTGAGGGTCTACTGTGAGAGTGACAAGGAGTACCACCATGTCCTTC

CTTACCAGGAGGCAGAGGACTATCCCTACGGACCAGTGGAGAACAAAATCAAAGTTCTGCAGTTTCTAGTCGATCAGTTCCTTACGACCAATATTGCTCG

TGAGGAGCTGATGTCTGAAGGGGTAATCCAGTATGACGACCATTGTAGGGTCTGTCACAAACTTGGGGATCTGCTGTGCTGTGAGACGTGCTCGGCTGTG

TACCATTTAGAGTGTGTGAAGCCGCCTCTTGAAGAAGTGCCGGAGGACGAGTGGCAGTGTGAAGTCTGTGTGGCACACAAGGTGCCTGGTGTGACTGACT

GTGTCGCTGAAGTCCAAAAGAATAAACCCTACGTTCGACACGAACCTATTGGGTATGACAGAAGCCGTAGGAAATACTGGTTTTTAAACCGAAGACTCAT

AAT AGAAGAAGACACAGACAATGAAAACGAGAAGAAAGTTTGGTACTACAGCACAAAGGTCCAGTTAGCAGAGCTAATAGACTGCCTAGACAAAGGATA

CTGGGAAGCAGAACTGTGCAGAGTTCTAGAAGACATTCGGGAGGAGATGCAGCAGCATATGGATGTAACGGAAGACCTGACCAACAAGGCTCGTGGCAGC

AACAAGTCCTTCCTAGCGGCAGCTAATG - UNI6861 - AGGAAATTTTGGACTCCTTAAGAATCAAACGAGGGGAAGATATTGACTGTGATCAGAGC

CCAGAAGACCCAGAAAAGGACAAGCATGAGGGCGAGAACAACAGCTCCAAGGATGCTGAGAAGAGCAGGGAGGAGGCGGAGGACCCTTCCGCAGACAAGG

ACGCTGACAGCAAAGGCCTGGAGGAAGAGCCCGGGCATGGAAAACCTGAGG AGCCAACAGAAGTTGGGGATAAAGGTAACTCTGTGCCAGCAAATCTTG

GCGACAACACAACAAATGCTTCTCCAGAAGAGACTAGTCCCTGTGACGGGAGGAGCCCCGAGGGCTGTCTCTCAGAGACCCATGATAGCAGCAGCATGGC

AGAGAAGAAGGTGGCATCTGAGCTCCCCCCGGATGTACCAG - UNI3072 - GTGATTTCAGACTGGAGAAGTCCAATGGAGAAGTTTCCGAGTCCCC

TGGAGCTGGGAAAGGAACATCTGGGTCCACTCGTATCATCACCAGACTGAGGAACCCGGAGAGCAAACTCAGTCAGCTCAAGAGTCAGCAGGTGGCAGCT

GCAGCCCATGAAGCAAATAAATTGTTTAAGGAGGGGAAAGAG GTGCTGGTGGTTAACTCCCAAGGAGAGGTTTCACGGCTGAGCACCAAAAAGGAGGTG

GTCATGAAAGGGAACATCAACAACTATTTTAAGCTGGGACAAGAAGGGAAGTATCGAGTCTACCACAATCAATACTCGACCAATTCATTTGCTCTGAATA

AACACCAGCACAGAGAAGACCATGATAAGAGGAGGCATCTTGCACATAAATTCTGTCTCACTCCAGCTGGGGAGTTCAAATGGAACGGGTCTGTTCACGG

GTCCAAAGTCCTTACCATCTCAACCCTGAGACTCACCATCACACAGCTAGAGAGCAACATTCCTTCATCCTTCCTTCACCCCAATTGGGCTTCACACAG 

GGCTAATTGGATCAAGGCCGTTCAGATGTGTAGTAAACCCAGAGAGTTTGCGTTGGCTCTCGCAATTCTGGAGTGTGCAGTTAAGCCAGTTGTGATGCTG

CCAATATGGCGGGAGTCTCTAGGACATACCCG - UNI29378 - GTTACATAGGATGACATCAATTGAAAGGGAAGAAAAAGAGAAAGTTAAAAAAAA

GGAGAAAAAACAAGAGGAGGAGGAGACAATGCAGCAGGCCACATGGGTAAAATACACATTTCCAGTGAAGCACCAG GTGACAGGGTACGGCGGCTGGAG

CTGGATTAGCAAGACGCACGTTTACAGATTTCTTCCCAAGTTACCAGGAAACACGAATGTAAACTACAGAAAGCCCTTGGATGGAG CCAAAAACAATAC

AGATGAAAATAAAGATGAGTCAGAGAAAAGGAAAAGTCCACGAAGTCCAAAAAAAATGAAGACAGAATGTGATTCTGAACAAGGTGAGACCAGAGATGCA

GATGCCACAGCTGGAGCCGCCGCAGGGGCAATGGAGCTGTCTAAGGAACCTGAGAAGAAGGATCAAG ATGTAAAAGAACTTTTAGATTCTGATAATGAC

AAATCCTTCAAGGAAGAACCAATGGAGATCGATGATACCATAAAAACAGAGTCACACGTGAGCAGTCTGGAAAGCACAGAGGTAGATGTAGTCAATGTTA

GTGAGGGCTTCCATCTAAGGACTAGTTACAAAAAGAAAACGAAATCCTCTAAGCTGGACGGGCTTCTGGAACGGAGGATTCGACAATTTACACTGGAAGA

AAAACAGCGTCTTGAGAAGTTAAAGCTGGAGAGTGGGGTGAAGGGGGCGGGGAAGCCCCCCATGGGTGCTCTGAAAAGCTCCTCTGAGTCTCCAGGCTCC

ACAAAAGCAAGCGAAGGGCATCAGGGTGACTCGCTGAGACAGGAACAAAGCCCCAGTTCAAGTCAGGCTAGCACTGTGGACTTGGGGCTGGGGGGCTCAC

AAAGTGATCCCTTGGTTCTTGGCATCAGTCCTCCTAGTCTAAGCACGCACAAACCTGATCCAAAAGATCAAGTATTAGATGATGTCTCCATTCAGAGTCC

AGGGCCAAACTGTCAGAGGCAAAACTCAGTTGAAAGCGACCTAGATGCCAGGATCTCTGAACCTGCCGGTAAGGGACTGGAACTAAGTCAGACTAAAACA

GAAGTGACTGACTCTTCCTCTGATGACTCTAAACCAACCAGTGCAGACGATGTTGGCATTTTGATCTGTAAGAGCAGAAAGCTGCACTCACAGGACGATA

GCAGCACCGTTGTGTCTTCTTCCAAGAGTACTTTACCTGCATCAGTACCTAAAAGTCCCCGTGACAGAGATGCCCGGGCCTTCTCAAAAGCAGTGGACTT

CGATGGGAGACTAGGTGGTGACTCTGAATATAGTAGCACTTTGGAAAATAGCTCTGATAATATGTGTATTCGGGACAGTGCTGAAGAAGATATGGTTGTT

CAGAACAGCAGTGAAGCCACCTCGAAACGGTTCATAGCTCCAGAACAAGGAGGAGAAAGCGTGGAGTCGACAAAATGTCAGGTAGTTTCTAAGTCCACTG

AAAACTGTGAAGACAAACTACAGGGTAAGGTAACTGAAGCAAACGGTAAGAAACTGGGCCAACATCCTCCAAAGCCAGAGGAGAGAGCAGTTAACAGATG

TACTGACCAAGTCAGCCTGCGACACAGCGTTGACAGAAAGAACAGTGAACCTCGAGAGTCTGAAAAGAAAGGACAGAAAGCAAATAAATTTCAAATAAAC

GGCAAAGATAGCAAAGCTAAGGGGTACCTGAAGGGGCCGGGCACGAAGGACGGCTCTGATGGTAAAGTTGTGAGTAGTGCTGTAGAACCAAAGGTCAATA

ATATCAATAAAGTCATCCCTGGGAATACCAAGTCACTGGCTGGGAAGGAATCTGCTGCGAAGCCGTTCATCAACGGTGACATCATTATGGAAGAGTTGAG

TGAACAAAACACTTCAGAAACCAACTCATACTCACTGAGTTCTTCAGATGCCAAAGGTAATCACCAAGATGGCCTCCATACCCTACCATCCACCAAAGAG

TCTGCCAGTACCCAGGTAATCACACCCCGAGCCCCTTGTCCAGATCGGAACTCACTTAGTCAGGTAGAAGATATGGAAACTGAAAGTCCAGAGGTTAAGA

GAGTTATCCCGTCTCCTGTTAGAACTGGAGAGGGCTCTAACCTTAGCAAGGGCTTCATGGATGACAATGGACTGCCTTCCAGCAAAGACGAGAACGTCAA

TGGAGAATCCCAAAGAAAGACGGTCATCACAGAAGTCACCACAATGACATCTACTGTTGCCACAGAATCAAAAACTGTCATTAAGGTAGCAAAAGGAGAC

AAGCAAACTGTGGTTTCTTCCACAGAAAATTGTGCCAGATCCACAGTCACAACTACCACTACCACTGTGACAAAGCTCTCCACACCCTCCCCAGACACCG

GTGTGGATACCATCTCTGTAAAGGAGCAGAGTAAAACCGTGGTCACCACGACAGTGACGGACTCCTTGACCACTGCAGGAAGCACACTGGTGACATCTAT

GACCGTGAGCAAAGAGTACTCCACGAGAGACAGGGTAAAGCTGATGAAGTTCTCACGACCCAAGAAGACCCGCTCAGGCACTGCCCTGCCGTCCTATAGG

AAGTTCGTTACCAAGAGCAGCAAAAAGAGCATATTTGTGTTACCTAATGATGACTTGAAAAAGCTGGCCAGGAAAGGAGGGATCCGGGAGGTCCCTTACT

TTAATTATAACGCGAAACCTGCCTTGGATATATGGCCATACCCTTCTCCTAGACCGACCTTTGGTATCACATGGAG GTATAGACTACAGACGGTAAAGT

CCTTGGCTGGAGTGAGCCTGATGTTACGGTTGCTGTGGGCCAGTTTGAGATGGGATGACATGGCAGCCAAGGCTCCTCCAGGAGGAGGGTCTACACGGAC

AG - UNI4570 - - UNI9390 - AAACATCTGAAACTGAAATCACAACCACTGAGATAATTAAGAGGCGTGATGTGGGCCCTTATGGCATTCGTTC

TGAGTATTGTATCAGGAAGATCATTTGCCCCATTGGAGTTCCAGAAGCACCAAAAG - UNI4570 - AAACACCCACACCTCAGCGGAAGGGCCTCCG

ATCAAGTGCACTTCGGCCAAAGAGACCAGAGACCCCCAAGCAGACGGGCCCTGTTATCATTGAGAGCTGGGTAGCAGAAGAAGAGCTGGAGCTCTGGGAG

ATCAGGGCTTTTGCTGAGAG AGTGGAGAAAGAAAAGGCTCAAGCAGCAGAGCAGCAGACCAAG AAACGTTTGGAGCAGCAGAAGCCTGCAGTCATCGC

AGCGTCCACCACGTCCCCAGCAAACAACACAAGCAGCACTGTCTCTCCAGCCCAGAAGGTGATGGTGGCTCCCTTAAGTGGCTCGGTCACCCCTGGAACA

AAGATGGTGCTGGCCACAAAAGTCGGCTCGCCTGCCACAGTCACATTCCAGCAAAACAAGAACTTCCATCAAACTTTTGCCACGTGGGTGAAGCAAGGCC

AGTCCAATTCAG - UNI319 - GCATGGTCCAGGTACAGCAGAAGGTCCTGGGGATCATTCCATCGACTACAGGTCCAAGCCAGCAAACCTTTACTTC

ATTCCAGCCCAGGACTGCAACTGTCACAATTAGGCCCAATACCTCAGCCTCTGCAGGAACCACTACCACATCACAG - UNI319 - GTGATCACAGGG

CCTCAGATCCGCCCTGGCATGACAGTGATTAGAACGCCACTCCAGCAGCCAGCACTGGGAAAGGCGATCATTCGAACACCAGTGGTGGTGCAGCCAG GC

ACACCCCAACAAGTTGTGACTCAAATCATCCGAGGACAGCCTGTTTCCACTGCCATCTCTGCTCCAAGTACAGCTTCCTCAGCACCTGTACAAAAGGGCT

TAACTCCAGGAGCAGCGGCTGGGCCTCTGCAGCCTTCAGCCCCACACAGCCCTCGTCCTCAGCAAGGGCAGGTGAAGCTCACCATGGCTCAGCTCACTCA

GCTCACGCAGGGCCAT GGCGGCAACCAAGGTTTAACAGTAGTGATTCAAGGACAAGGGCAGACTACTGGACAGTTGCAGTTGATACCTCAGGGGATGAC

AGTCCTTCCAGGGCCAGGGCAGCAGCTCATGCAAGCTGCAATGCCGAATGGCACCGTTCAGCGTTTCCTCTTTACCCCACTATCAACATCAGCCACGGCC

GCCAGCAGCAGCAGCAACAGCAGCAGCACCACTACTAATGCTACAGCAGCAG - UNI4795 - GCTCAGGGGAACAAAAACAGAGTAAAATATTACCC

CAGACCCAGGTACAACCAGCCACAACCCTGGCACCAACTCAGTCATCAAGTGTGAGTCCTGCAGAAGCCCAGCCACAGCCTGCTCAGCCTGCAGCACAAC

CCCAGCCCCAGCCCCAGCCCCCAGCTCAGCCTGAAGTCCAGACCCAGCCAGCTGTCTCGTCCCATGTCCCTTCTGAAACACAGCCCTCCCAAGCACAGAC

ATCTAAACCCCTGGTTGCAACACAGTGTCAGCCTCAGAGCAGTGTACAAGGACAGTCTCCTGTTCGAGTCCAGAGTCCACCACTGACTCGAATACGTCCA

TCAACTCCATCCCAAGTGACTCCTGGACAGCAACCCCAGGTTCAGACTACAGCTTCACAGCCGATTCCAATTCCGCCCCCCACATCTCTGCAGGCACCTT

CCCAAGGCCAGCCACAGTCACAGCCCCAGGTACAGTCTTCAACTCAAACTCTTTCATCAGGACAGACATTAAATCAAGTTACTGTTCTATCTCCATCCTG

TCCTCAGCCACAGCCCCAAGTCATTGCTGTGCCTCAGCTCCAGCAAGTCCAGGTTCTCTCTCAGATCCAGTCGCAGGTTGTGGCTCAGATACAGGCCCAG

CAAAGTGGTGTGCCCCAGCAAATCAAACTTCAGTTGCCCATTCAAGTTCAGCAAAACAGTGCTGCGCAGACTCAGAGTGTGGTCACAGTGCAGGCAGCCA

GTGTGCAGGAGCAGTTGCAGAGGGTTCAGCAACTCAGGGACCAGCAGCAAAAGAAGAAGCAGCAGATAGAAACTGAGCGTGAACACACCCTCCAAGCTTC

TAACCAAAGTGAGATCATTCAGAAACAG GTGGTGATGAAGCATAATGCTGTAATAGAACATTTAAAACAGAAAAAGACCATGACTCCAGCTGAAAGAGA

AGAAAATCAAAG GATGATTGTCTGTAACCAGGTGATGAAGTATATTCTGGATAAGATAGATAAAGAAGAAAAACAGGCGGCCAAGAAACGCAAGCGGGA

GGAGAGTGTGGAGCAGAAGCGGAGCAAACAGAATGCCAGCAAGCTCTCTGCTCTGCTGTTCAAACACAAGGAGCAGCTCAAAGCTGAGATCCTGAGAAAG

AGAGCGCTCCTGGACAAAGAGTTGCAGATCCAAGTGCAG - UNI2408 - - UNI14259 - - UNI18077 - GAAGAGCTGAAAAGAGACCTGA

AAATGAAACGAGAGAGGGAGATGGCCCAGGCGGTACAGGCCAATGCTGCCTCAGTGCCCACACCCTCCGTGCCAGCCCCTGTGCCAGCGCCTGCACCGGC

AGCCCCTCCAGCTCCTCCTCGTTCTCCGCCTCCCTCCACACACAGTCTGCCACCTGCAGGCCACCCCACAGCCCCACTGCCTGTCACTTCCCAGAAGAGG

AAGCGGGAGGAAGAGAAGGACTCTAAGTCCAAGAAGAAGAAGATGATCTCTACCACCTCTAAGGAGGCCAAGAAGGACACCAGGCTATATTGCATCTGCA

AGACACCGTACGATGAGTCCAA - UNI6145 - - UNI14259 - - UNI18077 - ATTTTATATTGGCTGTGATCGGTGTCAGAATTGGTACCA

CGGGCGCTGTGTTGGCATCTTGCAAAGTGAGGCAGATCTCATTGATGAGTATGTCTGTCCACAGTGCCAGTCGACAGAGGACGCCATGACAGTGCTCACA

CCACTGACAGAGAAAGATTATGAGGGCTTGAAGAGGGTGCTGCGCTCCTTACAG - UNI6145 - - UNI6151 - - UNI14259 - GCCCACAA

GATGGCGTGGCCTTTCCTTGAACCGGTAGACCCCAATGATGCACCGGATTATTACGGTGTTATTAAAGAGCCAATGG - UNI6151 - - UNI33645

 - ACCTTGCCACCATGGAAGAAAGAATACAAAAACGGTATTATGAAAAGCTGACAGAGTTCGTGGCAGATATGACCAAAATTTTTGATAACTGCCGTTA

TTACAATCCCCGTGACACCCCTTTTTACCAGTGTGCAGAAGTTCTTGAATCATTCTTTGTACAGAAACTAAAAGGATTCAAGGCCAGCAG - UNI2043

8 - - UNI33645 - GTCTCATAACAACAAGCTGCAATCTACAGCTCCTTAGAACTCAGCGTGTCTGTCACCTAAGCTAGACACAGCAAGTCTGGCGC

TCTGAACTATTTAAACTAAAGCGCCAGATATTTTCAGTCAGGCTTTCCTGACAAGACCGTAACCTCGTTCATATTGGTCACAACAGTCCAGTTGTATTCT

TGGCCAATTTTGTCCAACGGACAAAGGAAAAGCAAAGTCAACGGCACCGTTGTCTTGTCGAGAGCAAATGGCTTTACTATTGTGGCAGAAGCAGGAAACT

TTGTTTATTGGAAAAAAAAAAAAAAAAAAGAAAAAGCAAGAAAAAAAAAAAAAGATACTATGGGGTCAAGTGTAACTCCGTGGGATGCCACATCTGCTCT

TCAGTGAAGAAGCTGTTTAGAGTCTCAGAAAACTTTTTGACTGTATTTATTTATTGTTGCAAAAAAAAGACGCTTTTTTATTGCTGCCCTCATTTGTCAG

CTAATTATTTTTTCTTATACAAATCCAGCCCTGGTTCCGTGTATCCACCCTGTATCCTATCATGATTCCTGTAGGTGAAGTACAAGGCGACCTCTAGGTG

TCTTTTCTTTCTATGAAAGGAGCTGCTATGTACACATGTGCACACACAACTGGGAATCAACAATGAGTTTATTGTTCACGGGAGACACAAGTGAAGCTTG

CGGAAAGGTTGGGCTAAGTGGTCCTGGACTAACAGACTTCGTTGCCTTGAATACACCAGTACAAATTGTCATTTACTCTGCACCAGGCTAAATGAGCAAA

ATCTATTTGAAGGTATCTTGTTTGTAAACATTGTCAGATTCTAATTTTTTTCTTTTTGTATTAAAATTCAACTATGGATGTATACGAATCGAAATAAATG

GAGATCATTTTTCTCCCACAGATGGAGGTCTCTTTGAATGTGCGCTGTGATTACCTGTAAGCCTTTGTGGGGGACGGGGCGGGGGAGAGACCAGGAATGA

CAGGAAGACCTGGATTTCTCTAGAATAGCAGAGGCCCTTCCTTTCCTAAGTCCCTTCTCACCACATCAGAGAAAATCTCCAGGGAGCCGGTCCCTTGCAT

CTCTTGGTCATCCCTGTAATAACGGGAATATGACACAGTACAAGCTGCCTTCATCCCCGCCTTCCAAAACTGTAGACAGATTCCTGTGTGGGATGAAGGG

TGTTTGCTGGCCGGGTTCCTTGGGTTTTGTTTGTTGCAGTAGAGCAGGGTAGAGGGTAGAGCAGACAGGCTCGCCCTGCATCTTCCTCCTGCGGGTGCTC

TCACCCTCCCTCCCCTTGGAGCTGCTTGCTGTGTTGTGAAAACCAGCCAGGATTGAGTCAGGCTGCCTCGCAGATGTTTTCCTAGATTTGCACTAGTCCA

TGTTAGCCCTGTCCTGCTGGGTTCTAGAATCTACCTAGTTTTTGTTTTTTAAAAGCCGCCTCTGTGCATTTGGTGTCGCCCTGCTATGCAAAGCCTTCCC

CAGCCCTTAGTTTCTTGAAAGGAAACTGTGGCAGCAGTTGGCAAATTCTTCCTTATGACAGGCTCAGGTGTACAGGTTCTTCTGGGTCACGTGCTCTATG

GAAGCCTACTCCCTCTGTACATAAAAATGTCACTTTAGCCTGTGCTTACAGCTAAAGAGACTTAACTGCTCAATATGATAGCAAAGTTTTTGCTTAAACT

ATTAAGGTGGAAGTAGTTAAATACAGGCTATTTTGTTCTTTTAGTTTACAAAAAAGAAAAAAGAAAAAAAATGTTCCACGTTGTAGGCACTGTGCTGATG

CAAGAATTCTACATCCTAATAATACAAAGTGATTCTGCATCTGCCCACGTCCAGTATTCCTGTACTATCTATTCATATATCTAAGCATATATGGGCTTAA

TCACTTAAGCTTGTTGCAGCAAAAGCTTTCCTACCTGTAGGCAATAGATTGCTATGTTTTTAACAAATTGTAGCAAATTCTAAATAATCCTTTTTGTACG

TAATAGGACATTTCATCCTAAAAAATAAAGTAATGTTTTTGACATTGGATTCTGTGCAGTTTCTAATGAGACAATGACTGGTTGGGTCAATGTTTGCTAT

ATTTTTCTGAAGCTGTTGGCATTGCCAAGTTGTACAGAAATGGGGGTGGGTATGGGTTGTGGATTTCTGAGACCAGGAAGATGTTAATTTCTTATTTGTG

TACTTAATGATATAAAGACTTTTGCAGTTTCTATCACCATGTAAAGACATTTTATAGTTTTATCAGACTGTGGAGTTTTAGTCTTTCAACGTACATTTAT

TTCAAAAGCTGCTTTTCTACAGATCTCATTTGACCTTCTTCTACTCCTCAATAAAAGTGTTAGGCTGTCTGCTCCGTCCGGCAGACCAAGTGGTCCGATA

TGCGATATGGGTAGGACTCAGGTTCTGTGCCTAGAAGTTGTATTTCTTTGCTTTGATAGATTTCTTTGGCTAAAAGTATTTTTTAGCATTTCCTGTGTTC

ATCTCCAGATTCACAGTTTAAGACCATTTCTTAAGAGATATTTTCATAACGGCGGTAAGGCTTTTTTCTCCTGTGCAGGTTCTTCAGGGCTTGTATTTAC

TGTCCTGTGCTAGGTCAAAGAAATTGCGAACTTTTGGAGATGTTTTCTACAGTAAAAAAATGACCTTTTTCTATTTGGAGTGGCCTGGAGTGCTGTGTGG

GACCCTCCCAATGTGCTGCTGTCTGTAACCTGTCCTCTTAAGAGCTGCAAATAAAACTTCTCTCCCTGTCTCCG
Translation
MVSEEDEEEEEDGDAEETQDSEDEEEDDMEEDDDDSDYPEEMEDDDDDASYCTESSFRSHSTYSSTPG - UNI5381 - - UNI18463 - GRRKPR

VHRPRSPILEEKDIPPLEFPKSSEDLMVPNEHIMNVIAIYEVVRNFGNVLRLSPFCFEDFCAALVSQEQCTLMAEMHVALLKAVLREEDTSNTTFGPADL

KDSVNSTLYFIDGMTWPEVLRVYCESDKEYHHVLPYQEAEDYPYGPVENKIKVLQFLVDQFLTTNIAREELMSEGVIQYDDHCRVCHKLGDLLCCETCSA

VYHLECVKPPLEEVPEDEWQCEVCVAHKVPGVTDCVAEVQKNKPYVRHEPIGYDRSRRKYWFLNRRLII IEEDTDNENEKKVWYYSTKVQLAELIDCLD

KGYWEAELCRVLEDIREEMQQHMDVTEDLTNKARGSNKSFLAAANE - UNI6861 - EEILDSLRIKRGEDIDCDQSPEDPEKDKHEGENNSSKDAEK

SREEAEDPSADKDADSKGLEEEPGHGKPEE EPTEVGDKGNSVPANLGDNTTNASPEETSPCDGRSPEGCLSETHDSSSMAEKKVASELPPDVPG - UN

I3072 - GDFRLEKSNGEVSESPGAGKGTSGSTRIITRLRNPESKLSQLKSQQVAAAAHEANKLFKEGKE VLVVNSQGEVSRLSTKKEVVMKGNINNY

FKLGQEGKYRVYHNQYSTNSFALNKHQHREDHDKRRHLAHKFCLTPAGEFKWNGSVHGSKVLTISTLRLTITQLESNIPSSFLHPNWASHR RANWIKAV

QMCSKPREFALALAILECAVKPVVMLPIWRESLGHTR - UNI29378 - RLHRMTSIEREEKEKVKKKEKK     - UNI4570 - - UNI9390 

-  - UNI4570 -    - UNI319 -  - UNI319 -    - UNI4795 -    - UNI2408 - - UNI14259 - - UNI18077 -  - 

UNI6145 - - UNI14259 - - UNI18077 -  - UNI6145 - - UNI6151 - - UNI14259 -  - UNI6151 - - UNI33645 - 

 - UNI20438 - - UNI33645 - 

For any suggestions or comments, please send an email to unitrap@crg.es